ARHGEF1 Antikörper (AA 41-71)

Produktnummer ABIN5647328

Produktdetails anti-ARHGEF1 Antikörper

Target: ARHGEF1 (rho Guanine Nucleotide Exchange Factor (GEF) 1 (ARHGEF1))

Bindungsspezifität: AA 41-71

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ARHGEF1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 41-71 (EQNSQFQSLEQVKRRPAHLMALLQHVALQFE) from the human protein were used as the immunogen for the ARHGEF1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the ARHGEF1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu ARHGEF1

Target: ARHGEF1 (rho Guanine Nucleotide Exchange Factor (GEF) 1 (ARHGEF1))

Andere Bezeichnung: ARHGEF1 (ARHGEF1 Produkte)

Synonyme: arhgef1 antikoerper, cb473 antikoerper, zgc:158261 antikoerper, ARHGEF1 antikoerper, GEF1 antikoerper, LBCL2 antikoerper, LSC antikoerper, P115-RHOGEF antikoerper, SUB1.5 antikoerper, Lbcl2 antikoerper, Lsc antikoerper, Rho guanine nucleotide exchange factor (GEF) 1a antikoerper, Rho guanine nucleotide exchange factor 1 antikoerper, Rho guanine nucleotide exchange factor (GEF) 1 antikoerper, arhgef1a antikoerper, ARHGEF1 antikoerper, arhgef1 antikoerper, Arhgef1 antikoerper

Hintergrund: Rho guanine nucleotide exchange factor 1, also called p115-RhoGEF, is a protein that in humans is encoded by the ARHGEF1 gene. Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form a complex with G proteins and stimulate Rho-dependent signals. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.

UniProt: Q92888

Pathways: Neurotrophin Signalübertragung, Regulation of G-Protein Coupled Receptor Protein Signaling, Thromboxane A2 Receptor Signaling