ACCN1 Antikörper (AA 112-147)
-
- Target Alle ACCN1 Antikörper anzeigen
- ACCN1 (Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1))
-
Bindungsspezifität
- AA 112-147
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ACCN1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Antigen affinity purified
- Immunogen
- Amino acids 112-147 (ELLALLDVNLQIPDPHLADPSVLEALRQKANFKHYK from the human protein were used as the immunogen for the ACCN1 antibody.
- Isotyp
- IgG
- Top Product
- Discover our top product ACCN1 Primärantikörper
-
-
- Applikationshinweise
- Western blot: 0.5-1 μg/mL
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Lagerung
- -20 °C
- Informationen zur Lagerung
- After reconstitution, the ACCN1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- ACCN1 (Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1))
- Andere Bezeichnung
- ACCN1 / ASIC2 (ACCN1 Produkte)
- Synonyme
- ACCN antikoerper, ACCN1 antikoerper, ASIC2a antikoerper, BNC1 antikoerper, BNaC1 antikoerper, MDEG antikoerper, hBNaC1 antikoerper, ACIC2 antikoerper, Accn1 antikoerper, BNaC1a antikoerper, Mdeg antikoerper, BNC1k antikoerper, MDEG1 antikoerper, MDEG2 antikoerper, accn1 antikoerper, zASIC2 antikoerper, acid sensing ion channel subunit 2 antikoerper, acid-sensing (proton-gated) ion channel 2 antikoerper, ASIC2 antikoerper, Asic2 antikoerper, asic2 antikoerper
- Hintergrund
- Amiloride-sensitive cation channel 1, neuronal, also known as ASIC2, is a protein that in humans is encoded by the ACCN1 gene. This gene encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, 2 hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing. The member encoded by this gene may play a role in neurotransmission. In addition, a heteromeric association between this member and acid-sensing (proton-gated) ion channel 3 has been observed to co-assemble into proton-gated channels sensitive to gadolinium. Alternative splicing has been observed at this locus and two variants, encoding distinct isoforms, have been identified.
- UniProt
- Q16515
- Pathways
- Sensory Perception of Sound
-