BAX Antikörper (AA 17-48)

Produktnummer ABIN5647494

Produktdetails anti-BAX Antikörper

Target: BAX (BCL2-Associated X Protein (BAX))

Bindungsspezifität: AA 17-48

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BAX Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 17-48 (EQIMKTGALLLQGFIQDRAGRMGGEAPELALD) from the human protein were used as the immunogen for the Bax antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the Bax antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL,FACS: 1-2 μg/10^6 cells

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the Bax antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu BAX

Target: BAX (BCL2-Associated X Protein (BAX))

Andere Bezeichnung: Bax (BAX Produkte)

Synonyme: BAX-ALPHA antikoerper, bax-A antikoerper, xBax antikoerper, xlbax antikoerper, BAX antikoerper, bax antikoerper, fj16e01 antikoerper, wu:fc50b10 antikoerper, wu:fj16e01 antikoerper, BCL2L4 antikoerper, zgc:112983 antikoerper, BCL2 associated X, apoptosis regulator antikoerper, BCL2-associated X protein L homeolog antikoerper, BCL2-associated X protein antikoerper, bcl2-associated X protein, a antikoerper, bcl2-associated X protein, b antikoerper, BAX antikoerper, bax.L antikoerper, bax antikoerper, baxa antikoerper, Bax antikoerper, baxb antikoerper

Hintergrund: Apoptosis regulator BAX, also known as bcl-2-like protein 4, is a protein that in humans is encoded by the BAX gene. The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. Additionally, this protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene.

UniProt: Q07812

Pathways: p53 Signalweg, PI3K-Akt Signalweg, Apoptose, Caspase Kaskade in der Apoptose, Positive Regulation of Endopeptidase Activity, Unfolded Protein Response