Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

BAX Antikörper (AA 17-48)

BAX Reaktivität: Human, Maus, Ratte WB, FACS, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
Produktnummer ABIN5647494
  • Target Alle BAX Antikörper anzeigen
    BAX (BCL2-Associated X Protein (BAX))
    Bindungsspezifität
    • 37
    • 32
    • 18
    • 15
    • 15
    • 12
    • 11
    • 10
    • 9
    • 8
    • 8
    • 7
    • 6
    • 5
    • 4
    • 4
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 17-48
    Reaktivität
    • 256
    • 153
    • 139
    • 47
    • 32
    • 27
    • 25
    • 18
    • 16
    • 13
    • 9
    • 5
    • 3
    • 3
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    Human, Maus, Ratte
    Wirt
    • 168
    • 95
    • 3
    • 1
    Kaninchen
    Klonalität
    • 182
    • 85
    Polyklonal
    Konjugat
    • 132
    • 16
    • 13
    • 12
    • 10
    • 7
    • 5
    • 5
    • 5
    • 5
    • 5
    • 5
    • 5
    • 5
    • 5
    • 5
    • 5
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Dieser BAX Antikörper ist unkonjugiert
    Applikation
    • 229
    • 111
    • 73
    • 62
    • 52
    • 52
    • 50
    • 37
    • 37
    • 12
    • 11
    • 8
    • 5
    • 3
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Aufreinigung
    Antigen affinity purified
    Immunogen
    Amino acids 17-48 (EQIMKTGALLLQGFIQDRAGRMGGEAPELALD) from the human protein were used as the immunogen for the Bax antibody.
    Isotyp
    IgG
    Top Product
    Discover our top product BAX Primärantikörper
  • Applikationshinweise
    Optimal dilution of the Bax antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL,FACS: 1-2 μg/10^6 cells
    Beschränkungen
    Nur für Forschungszwecke einsetzbar
  • Buffer
    0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
    Lagerung
    -20 °C
    Informationen zur Lagerung
    After reconstitution, the Bax antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Target
    BAX (BCL2-Associated X Protein (BAX))
    Andere Bezeichnung
    Bax (BAX Produkte)
    Synonyme
    BAX-ALPHA antikoerper, bax-A antikoerper, xBax antikoerper, xlbax antikoerper, BAX antikoerper, bax antikoerper, fj16e01 antikoerper, wu:fc50b10 antikoerper, wu:fj16e01 antikoerper, BCL2L4 antikoerper, zgc:112983 antikoerper, BCL2 associated X, apoptosis regulator antikoerper, BCL2-associated X protein L homeolog antikoerper, BCL2-associated X protein antikoerper, bcl2-associated X protein, a antikoerper, bcl2-associated X protein, b antikoerper, BAX antikoerper, bax.L antikoerper, bax antikoerper, baxa antikoerper, Bax antikoerper, baxb antikoerper
    Hintergrund
    Apoptosis regulator BAX, also known as bcl-2-like protein 4, is a protein that in humans is encoded by the BAX gene. The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. Additionally, this protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene.
    UniProt
    Q07812
    Pathways
    p53 Signalweg, PI3K-Akt Signalweg, Apoptose, Caspase Kaskade in der Apoptose, Positive Regulation of Endopeptidase Activity, Unfolded Protein Response
Sie sind hier:
Kundenservice