HMGB1 Antikörper (AA 124-154)

Produktnummer ABIN5647575

Produktdetails anti-HMGB1 Antikörper

Target: HMGB1 (High Mobility Group Box 1 (HMGB1))

Bindungsspezifität: AA 124-154

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HMGB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 124-154 (DVAKKLGEMWNNTAADDKQPYEKKAAKLKEK) from the human protein were used as the immunogen for the HMGB1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the HMGB1 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the HMGB1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu HMGB1

Target: HMGB1 (High Mobility Group Box 1 (HMGB1))

Andere Bezeichnung: HMGB1 (HMGB1 Produkte)

Synonyme: HMG1 antikoerper, HMG3 antikoerper, SBP-1 antikoerper, DEF antikoerper, HMG-1 antikoerper, Hmg1 antikoerper, amphoterin antikoerper, p30 antikoerper, hmgb1 antikoerper, ik:tdsubc_1a5 antikoerper, wu:fb23c02 antikoerper, xx:tdsubc_1a5 antikoerper, zgc:56110 antikoerper, zgc:77104 antikoerper, hmg-1 antikoerper, hmg3 antikoerper, sbp-1 antikoerper, hmg1 antikoerper, HMGB1 antikoerper, Ac2-008 antikoerper, high mobility group box 1 antikoerper, high-mobility group box 1 antikoerper, high mobility group box 1a antikoerper, high mobility group box 1 L homeolog antikoerper, high mobility group protein B1 antikoerper, HMGB1 antikoerper, Hmgb1 antikoerper, hmgb1 antikoerper, hmgb1a antikoerper, hmgb1.L antikoerper, LOC100359149 antikoerper

Hintergrund: High mobility group box 1 protein, also known as high-mobility group protein 1 (HMG-1) and amphoterin, is a protein that in humans is encoded by the HMGB1 gene. This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein.

UniProt: P09429

Pathways: p53 Signalweg, Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development, Positive Regulation of Endopeptidase Activity, Regulation of Carbohydrate Metabolic Process, Toll-Like Receptors Cascades, Smooth Muscle Cell Migration, Inflammasome