ACADVL Antikörper (AA 538-576)
-
- Target Alle ACADVL Antikörper anzeigen
- ACADVL (Acyl-CoA Dehydrogenase, Very Long Chain (ACADVL))
-
Bindungsspezifität
- AA 538-576
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ACADVL Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Antigen affinity purified
- Immunogen
- Amino acids 538-576 (RALEQFATVVEAKLIKHKKGIVNEQFLLQRLADGAIDLY) from the human protein were used as the immunogen for the ACADVL antibody.
- Isotyp
- IgG
- Top Product
- Discover our top product ACADVL Primärantikörper
-
-
- Applikationshinweise
- Western blot: 0.5-1 μg/mL
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Lagerung
- -20 °C
- Informationen zur Lagerung
- After reconstitution, the ACADVL antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- ACADVL (Acyl-CoA Dehydrogenase, Very Long Chain (ACADVL))
- Andere Bezeichnung
- ACADVL / VLCAD (ACADVL Produkte)
- Synonyme
- ACAD6 antikoerper, LCACD antikoerper, VLCAD antikoerper, vlcad antikoerper, fb52d04 antikoerper, wu:fb52d04 antikoerper, wu:fc75e01 antikoerper, zgc:64067 antikoerper, acyl-CoA dehydrogenase very long chain antikoerper, acyl-Coenzyme A dehydrogenase, very long chain antikoerper, acyl-CoA dehydrogenase, very long chain antikoerper, ACADVL antikoerper, Acadvl antikoerper, acadvl antikoerper
- Hintergrund
- Very long-chain specific acyl-CoA dehydrogenase, mitochondrial (VLCAD) is an enzyme that in humans is encoded by the ACADVL gene. The protein encoded by this gene is targeted to the inner mitochondrial membrane, where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenaseis specific to long-chain and very-long-chain fatty acids. A deficiency in this gene product reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy. Alternative splicing results in multiple transcript variants encoding different isoforms.
- UniProt
- P49748
- Pathways
- ER-Nucleus Signaling, Monocarboxylic Acid Catabolic Process
-