MC2R Antikörper (AA 268-297)

Produktnummer ABIN5647725

Produktdetails anti-MC2R Antikörper

Target: MC2R (Melanocortin 2 Receptor (Adrenocorticotropic Hormone) (MC2R))

Bindungsspezifität: AA 268-297

Reaktivität: Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MC2R Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Kreuzreaktivität (Details): Expected species reactivity: Human

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 268-297 (NAVIDPFIYAFRSPELRDAFKKMIFCSRYW) from the human protein were used as the immunogen for the MC2R antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the MC2R antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the MC2R antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu MC2R

Target: MC2R (Melanocortin 2 Receptor (Adrenocorticotropic Hormone) (MC2R))

Andere Bezeichnung: MC2 Receptor / ACTH Receptor (MC2R Produkte)

Synonyme: ACTHR antikoerper, ACTH-R antikoerper, MC2-R antikoerper, MC2R antikoerper, MC2 antikoerper, melanocortin 2 receptor antikoerper, MC2R antikoerper, Mc2r antikoerper, mc2r antikoerper

Hintergrund: Melanocortin-2 receptor (MC2R), also known as ACTH receptor (ACTHR), is a member of the G protein-coupled receptor family. This gene is mapped to 18p11.2. MC2R is selectively activated by adrenocorticotropic hormone, whereas the other four melanocortin receptors recognize a variety of melanocortin ligands. Mutations in MC2R can result in familial glucocorticoid deficiency. Alternate transcript variants have been found for this gene.

UniProt: Q01718

Pathways: cAMP Metabolic Process