DHODH Antikörper (AA 132-173)
-
- Target Alle DHODH Antikörper anzeigen
- DHODH (Dihydroorotate Dehydrogenase (DHODH))
-
Bindungsspezifität
- AA 132-173
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DHODH Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Aufreinigung
- Antigen affinity purified
- Immunogen
- Amino acids 132-173 (RVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTED) from the human protein were used as the immunogen for the DHODH antibody.
- Isotyp
- IgG
- Top Product
- Discover our top product DHODH Primärantikörper
-
-
- Applikationshinweise
- Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Lagerung
- -20 °C
- Informationen zur Lagerung
- After reconstitution, the DHODH antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- DHODH (Dihydroorotate Dehydrogenase (DHODH))
- Andere Bezeichnung
- DHODH (DHODH Produkte)
- Hintergrund
- Dihydroorotate dehydrogenase is an enzyme that in humans is encoded by the DHODH gene on chromosome 16. The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane.
- UniProt
- Q02127
- Pathways
- Ribonucleoside Biosynthetic Process, Protein targeting to Nucleus
-