SUB1 Antikörper (AA 96-127)
-
- Target Alle SUB1 Antikörper anzeigen
- SUB1 (Activated RNA Polymerase II Transcriptional Coactivator p15 (SUB1))
-
Bindungsspezifität
- AA 96-127
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SUB1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Aufreinigung
- Antigen affinity purified
- Immunogen
- Amino acids 96-127 (MKPGRKGISLNPEQWSQLKEQISDIDDAVRKL) from the human protein were used as the immunogen for the PC4 antibody.
- Isotyp
- IgG
- Top Product
- Discover our top product SUB1 Primärantikörper
-
-
- Applikationshinweise
- Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Lagerung
- -20 °C
- Informationen zur Lagerung
- After reconstitution, the PC4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- SUB1 (Activated RNA Polymerase II Transcriptional Coactivator p15 (SUB1))
- Andere Bezeichnung
- PC4 / Positive cofactor 4 (SUB1 Produkte)
- Hintergrund
- Activated RNA polymerase II transcriptional coactivator p15, also known as Positive cofactor 4 (PC4) or SUB1 homolog, is a protein that in humans is encoded by the SUB1 gene. This gene is mapped to 5p13.3. The transcriptional cofactor PC4 is an ancient single-strand DNA (ssDNA)-binding protein that has a homologue in bacteriophage T5 where it is likely the elusive replicative ssDNA-binding protein. The recombinant PC4 is shown to function identically to the native protein through its interaction with TAFs.
- UniProt
- P53999
-