PDE5A Antikörper (AA 20-63)

Produktnummer ABIN5647895

Produktdetails anti-PDE5A Antikörper

Target: PDE5A (phosphodiesterase 5A, cGMP-Specific (PDE5A))

Bindungsspezifität: AA 20-63

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PDE5A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 20-63 (QKQQQRDQDSVEAWLDDHWDFTFSYFVRKATREMVNAWFAERVH) from the human protein were used as the immunogen for the PDE5A antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the PDE5A antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the PDE5A antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu PDE5A

Target: PDE5A (phosphodiesterase 5A, cGMP-Specific (PDE5A))

Andere Bezeichnung: PDE5 (PDE5A Produkte)

Synonyme: CGB-PDE antikoerper, CN5A antikoerper, PDE5 antikoerper, PDE5A2 antikoerper, Cgbpde antikoerper, Cn5n antikoerper, Pde5 antikoerper, Pde5a1 antikoerper, PDE5A antikoerper, pde5a antikoerper, cgb-pde antikoerper, cn5a antikoerper, pde5 antikoerper, pde5a1 antikoerper, phosphodiesterase 5A antikoerper, phosphodiesterase 5A, cGMP-specific antikoerper, phosphodiesterase 5A S homeolog antikoerper, phosphodiesterase 5A, cGMP-specific, b antikoerper, PDE5A antikoerper, Pde5a antikoerper, pde5a.S antikoerper, pde5ab antikoerper, pde5a antikoerper

Hintergrund: CGMP-specific phosphodiesterase type 5 is an enzyme from the phosphodiesterase class. It is found in various tissues, most prominently the corpus cavernosum and the retina. It has also been recently discovered to play a vital role in the cardiovascular system. Furthermore, PDE5A also plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides. This PDE5A gene is mapped to 4q26.

UniProt: O76074

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling