Peptide YY Antikörper (AA 29-64)

Produktnummer ABIN5647902

Produktdetails anti-Peptide YY Antikörper

Target: Peptide YY (PYY)

Bindungsspezifität: AA 29-64

Reaktivität: Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Peptide YY Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 29-64 (YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY) from the mouse protein were used as the immunogen for the PYY antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: Prior to reconstitution, store at 4°C. After reconstitution, the PYY antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu Peptide YY

Target: Peptide YY (PYY)

Andere Bezeichnung: PYY / Peptide YY (PYY Produkte)

Synonyme: PYY-I antikoerper, PYY1 antikoerper, GHYY antikoerper, RATGHYY antikoerper, Yy antikoerper, peptide-YY antikoerper, peptide YY antikoerper, peptide YY (mapped) antikoerper, PYY antikoerper, Pyy antikoerper

Hintergrund: Peptide YY (PYY), also known as peptide tyrosine tyrosine, is a peptide that in humans is encoded by the PYY gene. This gene encodes a member of the neuropeptide Y (NPY) family of peptides. The encoded preproprotein is proteolytically processed to generate two alternative peptide products that differ in length by three amino acids. These peptides, secreted by endocrine cells in the gut, exhibit different binding affinities for each of the neuropeptide Y receptors. Binding of the encoded peptides to these receptors mediates regulation of pancreatic secretion, gut mobility and energy homeostasis. Rare variations in this gene could increase susceptibility to obesity and elevated serum levels of the encoded peptides may be associated with anorexia nervosa.

UniProt: Q9EPS2