GRIN1/NMDAR1 Antikörper
-
- Target Alle GRIN1/NMDAR1 (GRIN1) Antikörper anzeigen
- GRIN1/NMDAR1 (GRIN1) (Glutamate Receptor, Ionotropic, N-Methyl D-Aspartate 1 (GRIN1))
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GRIN1/NMDAR1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Marke
- Picoband™
- Sequenz
- FIEIAYKRHK DARRKQMQLA FAAVNVWRKN LQDRK
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
- Rabbit IgG polyclonal antibody for NMDAR1 detection. Tested with WB in Human,Mouse,Rat.
- Immunogen
- A synthetic peptide corresponding to a sequence of human NMDAR1 (FIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRK).
- Top Product
- Discover our top product GRIN1 Primärantikörper
-
-
- Applikationshinweise
-
Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.
Application Details: Western blot, 0.1-0.5 μg/mL
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
-
-
Mechanisms responsible for the effect of median nerve electrical stimulation on traumatic brain injury-induced coma: orexin-A-mediated N-methyl-D-aspartate receptor subunit NR1 upregulation." in: Neural regeneration research, Vol. 11, Issue 6, pp. 951-6, (2016) (PubMed).
: "
-
Mechanisms responsible for the effect of median nerve electrical stimulation on traumatic brain injury-induced coma: orexin-A-mediated N-methyl-D-aspartate receptor subunit NR1 upregulation." in: Neural regeneration research, Vol. 11, Issue 6, pp. 951-6, (2016) (PubMed).
-
- Target
- GRIN1/NMDAR1 (GRIN1) (Glutamate Receptor, Ionotropic, N-Methyl D-Aspartate 1 (GRIN1))
- Andere Bezeichnung
- GRIN1 (GRIN1 Produkte)
- Synonyme
- GluN1 antikoerper, MRD8 antikoerper, NMDA1 antikoerper, NMDAR1 antikoerper, NR1 antikoerper, nmda1 antikoerper, nmdar1 antikoerper, GB19253 antikoerper, GRIN1 antikoerper, NMD-R1 antikoerper, Z16 antikoerper, GluRdelta1 antikoerper, GluRzeta1 antikoerper, M100174 antikoerper, Nmdar antikoerper, Rgsc174 antikoerper, NMDAR1.1 antikoerper, zgc:152678 antikoerper, glutamate ionotropic receptor NMDA type subunit 1 antikoerper, glutamate receptor, ionotropic, N-methyl D-aspartate 1 S homeolog antikoerper, NMDA receptor 1 antikoerper, G protein-regulated inducer of neurite outgrowth 1 antikoerper, glutamate receptor, ionotropic, NMDA1 (zeta 1) antikoerper, glutamate receptor, ionotropic, N-methyl D-aspartate 1a antikoerper, GRIN1 antikoerper, grin1.S antikoerper, grin1 antikoerper, Grin1 antikoerper, Nmdar1 antikoerper, Gprin1 antikoerper, grin1a antikoerper
- Hintergrund
-
Synonyms: Glutamate receptor ionotropic, NMDA 1, GluN1, Glutamate [NMDA] receptor subunit zeta-1, N-methyl-D-aspartate receptor subunit NR1, NMD-R1, GRIN1, NMDAR1
Background: Glutamate [NMDA] receptor subunit zeta-1 is a protein that in humans is encoded by the GRIN1 gene. The protein encoded by this gene is a critical subunit of N-methyl-D-aspartate receptors, members of the glutamate receptor channel superfamily which are heteromeric protein complexes with multiple subunits arranged to form a ligand-gated ion channel. These subunits play a key role in the plasticity of synapses, which is believed to underlie memory and learning. Cell-specific factors are thought to control expression of different isoforms, possibly contributing to the functional diversity of the subunits. Alternatively spliced transcript variants have been described.
- UniProt
- Q05586
- Pathways
- Synaptic Membrane, Feeding Behaviour, Regulation of long-term Neuronal Synaptic Plasticity
-