SP6 Antikörper
-
- Target Alle SP6 Antikörper anzeigen
- SP6 (Sp6 Transcription Factor (SP6))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SP6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Marke
- Picoband™
- Sequenz
- QPDMSHHYES WFRPTHPGAE DGSWWDLHPG TSWMDLPH
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
- Rabbit IgG polyclonal antibody for SP6 detection. Tested with WB in Human,Mouse,Rat.
- Immunogen
- A synthetic peptide corresponding to a sequence of human SP6 (QPDMSHHYESWFRPTHPGAEDGSWWDLHPGTSWMDLPH).
- Top Product
- Discover our top product SP6 Primärantikörper
-
-
- Applikationshinweise
-
Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.
Application Details: Western blot, 0.1-0.5 μg/mL
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- SP6 (Sp6 Transcription Factor (SP6))
- Andere Bezeichnung
- SP6 (SP6 Produkte)
- Synonyme
- xsp6 antikoerper, MGC131081 antikoerper, EPFN antikoerper, EPIPROFIN antikoerper, KLF14 antikoerper, 1110025J03Rik antikoerper, AA591031 antikoerper, AI592962 antikoerper, Epfn antikoerper, Klf14 antikoerper, Sp6 transcription factor antikoerper, Sp5 transcription factor L homeolog antikoerper, trans-acting transcription factor 6 antikoerper, SP6 antikoerper, sp5.L antikoerper, Sp6 antikoerper
- Hintergrund
-
Synonyms: Transcription factor Sp6, Krueppel-like factor 14, SP6, KLF14
Tissue Specificity: Ubiquitous.
Background: SP6 belongs to a family of transcription factors that contain 3 classical zinc finger DNA-binding domains consisting of a zinc atom tetrahedrally coordinated by 2 cysteines and 2 histidines (C2H2 motif). These transcription factors bind to GC-rich sequences and related GT and CACCC boxes. By somatic cell hybrid analysis and FISH, he SP6 gene is mapped t to chromosome 17q21.3-q22.
-