CCKBR Antikörper
-
- Target Alle CCKBR Antikörper anzeigen
- CCKBR (Cholecystokinin B Receptor (CCKBR))
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CCKBR Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Frozen Sections) (IHC (fro)), Immunocytochemistry (ICC)
- Marke
- Picoband™
- Sequenz
- PVYTVVQPVG PRVLQCVHRW PSARVRQTWS
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
- Rabbit IgG polyclonal antibody for CCKBR detection. Tested with WB, IHC-F, ICC, FCM in Human,Mouse,Rat.
- Immunogen
- A synthetic peptide corresponding to a sequence of human CCKBR (PVYTVVQPVGPRVLQCVHRWPSARVRQTWS).
- Top Product
- Discover our top product CCKBR Primärantikörper
-
-
- Applikationshinweise
-
Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(F) and ICC.
Application Details: Western blot, 0.1-0.5 μg/mL
Immunohistochemistry(Frozen Section), 0.5-1 μg/mL, Human
Immunocytochemistry, 0.5-1 μg/mL, Human
Flow Cytometry, 1-3 μg/1x106 cells, Human - Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
-
-
Changes in FABP1 and gastrin receptor expression in the testes of rats that have undergone electrical injury." in: Experimental and therapeutic medicine, Vol. 9, Issue 6, pp. 2155-2158, (2015) (PubMed).
: "
-
Changes in FABP1 and gastrin receptor expression in the testes of rats that have undergone electrical injury." in: Experimental and therapeutic medicine, Vol. 9, Issue 6, pp. 2155-2158, (2015) (PubMed).
-
- Target
- CCKBR (Cholecystokinin B Receptor (CCKBR))
- Andere Bezeichnung
- CCKBR (CCKBR Produkte)
- Hintergrund
-
Synonyms: Gastrin/cholecystokinin type B receptor, CCK-B receptor, CCK-BR, Cholecystokinin-2 receptor, CCK2-R, CCKBR, CCKRB
Tissue Specificity: Isoform 1 is expressed in brain, pancreas, stomach, the colon cancer cell line LoVo and the T-lymphoblastoma Jurkat, but not in heart, placenta, liver, lung, skeletal muscle, kidney or the stomach cancer cell line AGS. Expressed at high levels in the small cell lung cancer cell line NCI-H510, at lower levels in NCI-H345, NCI-H69 and GLC-28 cell lines, not expressed in GLC-19 cell line. Within the stomach, expressed at high levels in the mucosa of the gastric fundus and at low levels in the antrum and duodenum. Isoform 2 is present in pancreatic cancer cells and colorectal cancer cells, but not in normal pancreas or colonic mucosa. Isoform 3 is expressed in brain, pancreas, stomach, the stomach cancer cell line AGS and the colon cancer cell line LoVo.
Background: The cholecystokinin B receptor, also known as CCKBR or CCK2, is a protein that in humans is encoded by the CCKBR gene. This gene encodes a G-protein coupled receptor for gastrin and cholecystokinin (CCK), regulatory peptides of the brain and gastrointestinal tract. This protein is a type B gastrin receptor, which has a high affinity for both sulfated and nonsulfated CCK analogs and is found principally in the central nervous system and the gastrointestinal tract. Alternative splicing results in multiple transcript variants. A misspliced transcript variant including an intron has been observed in cells from colorectal and pancreatic tumors.
- UniProt
- P32239
- Pathways
- Positive Regulation of Peptide Hormone Secretion, Feeding Behaviour
-