STAR Antikörper
-
- Target Alle STAR Antikörper anzeigen
- STAR (Steroidogenic Acute Regulatory Protein (STAR))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser STAR Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Marke
- Picoband™
- Sequenz
- EETLYSDQEL AYLQQGEEAM QKALGILSNQ EGWKKESQQD
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
- Rabbit IgG polyclonal antibody for StAR detection. Tested with WB in Human,Mouse,Rat.
- Immunogen
- A synthetic peptide corresponding to a sequence of human StAR (EETLYSDQELAYLQQGEEAMQKALGILSNQEGWKKESQQD).
- Top Product
- Discover our top product STAR Primärantikörper
-
-
- Applikationshinweise
-
Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.
Application Details: Western blot,0.1-0.5 μg/mL
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- STAR (Steroidogenic Acute Regulatory Protein (STAR))
- Andere Bezeichnung
- STAR (STAR Produkte)
- Synonyme
- STARD1 antikoerper, AV363654 antikoerper, D8Ertd419e antikoerper, star antikoerper, LOC100219165 antikoerper, StARD1 antikoerper, steroidogenic acute regulatory protein antikoerper, steroidogenic acute regulatory protein L homeolog antikoerper, STAR antikoerper, Star antikoerper, star antikoerper, star.L antikoerper
- Hintergrund
-
Synonyms: Steroidogenic acute regulatory protein, mitochondrial, StAR, START domain-containing protein 1, StARD1, STAR, STARD1
Tissue Specificity: Expressed in gonads, adrenal cortex and kidney.
Background: The steroidogenic acute regulatory protein, commonly referred to as StAR (STARD1), is a transport protein. This protein plays a key role in the acute regulation of steroid hormone synthesis by enhancing the conversion of cholesterol into pregnenolone. It permits the cleavage of cholesterol into pregnenolone by mediating the transport of cholesterol from the outer mitochondrial membrane to the inner mitochondrial membrane. Mutations in this gene are a cause of congenital lipoid adrenal hyperplasia (CLAH), also called lipoid CAH. A pseudogene of this gene is located on chromosome 13.
- UniProt
- P49675
- Pathways
- Metabolism of Steroid Hormones and Vitamin D, Response to Growth Hormone Stimulus, C21-Steroid Hormone Metabolic Process, Cellular Response to Molecule of Bacterial Origin, Carbohydrate Homeostasis
-