CEP68 Antikörper
-
- Target Alle CEP68 Antikörper anzeigen
- CEP68 (Centrosomal Protein 68kDa (CEP68))
- Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CEP68 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Marke
- Picoband™
- Sequenz
- ELICWLYNVA DVTDHGTAAR SNLTSLKSSL QLYRQFKKDI D
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
- Rabbit IgG polyclonal antibody for CEP68 detection. Tested with WB in Human,Mouse,Rat.
- Immunogen
- A synthetic peptide corresponding to a sequence of human CEP68 (ELICWLYNVADVTDHGTAARSNLTSLKSSLQLYRQFKKDID).
- Top Product
- Discover our top product CEP68 Primärantikörper
-
-
- Applikationshinweise
-
Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.
Application Details: Western blot, 0.1-0.5 μg/mL
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- CEP68 (Centrosomal Protein 68kDa (CEP68))
- Andere Bezeichnung
- CEP68 (CEP68 Produkte)
- Synonyme
- RGD1309101 antikoerper, 6030463E10Rik antikoerper, AI481761 antikoerper, BC027174 antikoerper, Kiaa0582 antikoerper, KIAA0582 antikoerper, centrosomal protein 68 antikoerper, Cep68 antikoerper, CEP68 antikoerper
- Hintergrund
-
Synonyms: Centrosomal protein of 68 kDa, Cep68, CEP68, KIAA0582
Background: Centrosomal protein of 68 kDa is a protein that in humans is encoded by the CEP68 gene. It is mapped to chromosome 2. CEP68 is required for centrosome cohesion. It decorates fibres emanating from the proximal ends of centrioles. CEP68 and rootletin depend both on each other for centriole association, and both also require CEP250 for their function.
- UniProt
- Q76N32
- Pathways
- SARS-CoV-2 Protein Interaktom
-