14-3-3 zeta Antikörper
-
- Target Alle 14-3-3 zeta (YWHAZ) Antikörper anzeigen
- 14-3-3 zeta (YWHAZ)
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser 14-3-3 zeta Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Marke
- Picoband™
- Sequenz
- LLEKFLIPNA SQAESKVFYL KMKGDYYRYL AEVAAGDDKK GIVDQ
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
- Rabbit IgG polyclonal antibody for 14-3-3 zeta/delta detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Immunogen
- A synthetic peptide corresponding to a sequence of human 14-3-3 zeta/delta (LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ).
- Top Product
- Discover our top product YWHAZ Primärantikörper
-
-
- Applikationshinweise
-
Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).
Application Details: Western blot, 0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL - Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- 14-3-3 zeta (YWHAZ)
- Andere Bezeichnung
- YWHAZ (YWHAZ Produkte)
- Synonyme
- 14-3-3-zeta antikoerper, KCIP-1 antikoerper, YWHAD antikoerper, 14-3-3zeta antikoerper, Ywhaz antikoerper, ACYPI003154 antikoerper, 14-3-3z antikoerper, kcip-1 antikoerper, ywhaq antikoerper, 1433z antikoerper, ywhaz antikoerper, ywhazb antikoerper, 1110013I11Rik antikoerper, AI596267 antikoerper, AL022924 antikoerper, AU020854 antikoerper, ywhaza antikoerper, fb14h09 antikoerper, wu:fb05g08 antikoerper, wu:fb14h09 antikoerper, ywhai antikoerper, zgc:55807 antikoerper, 14-3-3 antikoerper, 14-3-3 zeta antikoerper, 14-3-3ZETA antikoerper, 14-3-3leo antikoerper, 2G1 antikoerper, 4-3-3 zeta antikoerper, 5.11 antikoerper, 549 antikoerper, BEST:GH05075 antikoerper, CG17870 antikoerper, D14-3-3 antikoerper, D14-3-3zeta antikoerper, Dmel\\CG17870 antikoerper, K antikoerper, LEO antikoerper, Leo antikoerper, PAR-5 antikoerper, PAR5 antikoerper, Par-5 antikoerper, d14-3-3zeta antikoerper, l(2)07103 antikoerper, l(2)46CFe antikoerper, l(2)46Ee antikoerper, leo antikoerper, par-5 antikoerper, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta antikoerper, 14-3-3 protein zeta antikoerper, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta L homeolog antikoerper, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide antikoerper, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta antikoerper, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta S homeolog antikoerper, 14-3-3 protein zeta/delta pseudogene antikoerper, CG17870 gene product from transcript CG17870-RE antikoerper, YWHAZ antikoerper, 14-3-3zeta antikoerper, ywhaz antikoerper, 1433z antikoerper, ywhaz.L antikoerper, Ywhaz antikoerper, ywhaz.S antikoerper, LOC100855903 antikoerper
- Hintergrund
-
Synonyms: 14-3-3 protein zeta/delta, Protein kinase C inhibitor protein 1, KCIP-1, YWHAZ
Background: 14-3-3 protein zeta/delta (14-3-3ζ) is a protein that in humans is encoded by the YWHAZ gene on chromosome 8. This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99 % identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene.
- UniProt
- P63104
- Pathways
- Apoptose, Hormone Transport, Myometrial Relaxation and Contraction, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Synaptic Membrane, Production of Molecular Mediator of Immune Response, Maintenance of Protein Location
-