L1CAM Antikörper
-
- Target Alle L1CAM Antikörper anzeigen
- L1CAM (L1 Cell Adhesion Molecule (L1CAM))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser L1CAM Antikörper ist unkonjugiert
-
Applikation
- Immunohistochemistry (IHC)
- Sequenz
- NMVITWKPLR WMDWNAPQVQ YRVQWRPQGT RGPW
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
- Rabbit IgG polyclonal antibody for L1CAM detection. Tested with IHC-P in Human,Mouse,Rat.
- Immunogen
- A synthetic peptide corresponding to a sequence of human L1CAM (NMVITWKPLRWMDWNAPQVQYRVQWRPQGTRGPW).
- Top Product
- Discover our top product L1CAM Primärantikörper
-
-
- Applikationshinweise
-
Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.
Application Details: Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- L1CAM (L1 Cell Adhesion Molecule (L1CAM))
- Andere Bezeichnung
- L1CAM (L1CAM Produkte)
- Synonyme
- l1cam-a antikoerper, CAML1 antikoerper, CD171 antikoerper, HSAS antikoerper, HSAS1 antikoerper, MASA antikoerper, MIC5 antikoerper, N-CAM-L1 antikoerper, N-CAML1 antikoerper, NCAM-L1 antikoerper, S10 antikoerper, SPG1 antikoerper, L1 antikoerper, Hsas antikoerper, Hyd antikoerper, NCAML1 antikoerper, L1 cell adhesion molecule S homeolog antikoerper, L1 cell adhesion molecule antikoerper, l1cam.S antikoerper, L1CAM antikoerper, L1cam antikoerper
- Hintergrund
-
Synonyms: Neural cell adhesion molecule L1, N-CAM-L1, NCAM-L1, CD171, L1CAM, CAML1, MIC5
Background: L1, also known as L1CAM, is a transmembrane protein member of the L1 protein family, encoded by the L1CAM gene. The protein encoded by this gene is an axonal glycoprotein belonging to the immunoglobulin supergene family. The ectodomain, consisting of several immunoglobulin-like domains and fibronectin-like repeats (type III), is linked via a single transmembrane sequence to a conserved cytoplasmic domain. This cell adhesion molecule plays an important role in nervous system development, including neuronal migration and differentiation. Mutations in the gene cause X-linked neurological syndromes known as CRASH (corpus callosum hypoplasia, retardation, aphasia, spastic paraplegia and hydrocephalus). Alternative splicing of this gene results in multiple transcript variants, some of which include an alternate exon that is considered to be specific to neurons.
- UniProt
- P32004
- Pathways
- Synaptic Membrane
-