NFIB Antikörper
-
- Target Alle NFIB Antikörper anzeigen
- NFIB (Nuclear Factor I/B (NFIB))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NFIB Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Aufreinigung
- Antigen affinity purified
- Immunogen
- Amino acids ELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQR were used as the immunogen for the NFIB antibody.
- Isotyp
- IgG
- Top Product
- Discover our top product NFIB Primärantikörper
-
-
- Applikationshinweise
- Optimal dilution of the NFIB antibody should be determined by the researcher.\. Western blot: 0.5-1 μg/mL, IHC (FFPE): 1-2 μg/mL
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Lagerung
- -20 °C
- Informationen zur Lagerung
- After reconstitution, the NFIB antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- NFIB (Nuclear Factor I/B (NFIB))
- Andere Bezeichnung
- NFIB / Nuclear factor 1 B-type (NFIB Produkte)
- Synonyme
- NFIB antikoerper, nf1-b1 antikoerper, CTF antikoerper, HMGIC/NFIB antikoerper, NF-I/B antikoerper, NF1-B antikoerper, NFI-B antikoerper, NFI-RED antikoerper, NFIB2 antikoerper, NFIB3 antikoerper, 6720429L07Rik antikoerper, E030026I10Rik antikoerper, nuclear factor I B antikoerper, nuclear factor 1 B-type antikoerper, nuclear factor I B L homeolog antikoerper, nuclear factor I/B antikoerper, NFIB antikoerper, LOC100221557 antikoerper, nfib.L antikoerper, Nfib antikoerper
- Hintergrund
- Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication. [UniProt]
- UniProt
- O00712
-