Regucalcin Antikörper
-
- Target Alle Regucalcin (RGN) Antikörper anzeigen
- Regucalcin (RGN)
- Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Regucalcin Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Aufreinigung
- Antigen affinity purified
- Immunogen
- Amino acids YSVDAFDYDLQTGQISNRRSVYKLEKEEQIPD were used as the immunogen for the Regucalcin antibody.
- Isotyp
- IgG
- Top Product
- Discover our top product RGN Primärantikörper
-
-
- Applikationshinweise
- Optimal dilution of the Regucalcin antibody should be determined by the researcher.\. Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Lagerung
- -20 °C
- Informationen zur Lagerung
- After reconstitution, the Regucalcin antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- Regucalcin (RGN)
- Andere Bezeichnung
- Regucalcin (RGN Produkte)
- Synonyme
- CG1803 antikoerper, Dmel\\CG1803 antikoerper, Regucalcin antikoerper, T1 antikoerper, GNL antikoerper, zgc:92078 antikoerper, smp30 antikoerper, xsmp-30 antikoerper, xsmp30 antikoerper, DyakGE16489 antikoerper, dyak_GLEANR_17905 antikoerper, GE16489 antikoerper, regucalcin antikoerper, SMP30 antikoerper, AI265316 antikoerper, RC antikoerper, rgn-A antikoerper, Rc antikoerper, Reguc antikoerper, SMP-30 antikoerper, CG1803 gene product from transcript CG1803-RA antikoerper, regucalcin antikoerper, GE16489 gene product from transcript GE16489-RB antikoerper, regucalcin (senescence marker protein-30) antikoerper, regucalcin L homeolog antikoerper, regucalcin antikoerper, rgn antikoerper, LOC465598 antikoerper, RGN antikoerper, Dyak\regucalcin antikoerper, Rgn antikoerper, rgn.L antikoerper
- Hintergrund
- Regucalcin is a protein that in humans is encoded by the RGN gene. The protein encoded by this gene is a highly conserved, calcium-binding protein, that is preferentially expressed in the liver and kidney. It may have an important role in calcium homeostasis. Studies in rat indicate that this protein may also play a role in aging, as it shows age-associated down-regulation. This gene is part of a gene cluster on chromosome Xp11.3-Xp11.23.
- UniProt
- Q15493
-