CHRNA3 Antikörper
-
- Target Alle CHRNA3 Antikörper anzeigen
- CHRNA3 (Cholinergic Receptor, Nicotinic, alpha 3 (Neuronal) (CHRNA3))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CHRNA3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Flow Cytometry (FACS)
- Aufreinigung
- Antigen affinity purified
- Immunogen
- Amino acids DAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQD from the human protein were used as the immunogen for the CHRNA3 antibody.
- Isotyp
- IgG
- Top Product
- Discover our top product CHRNA3 Primärantikörper
-
-
- Applikationshinweise
- Optimal dilution of the CHRNA3 antibody should be determined by the researcher.\. Western blot: 0.5-1 μg/mL,FACS: 1-3 μg/10^6 cells
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Lagerung
- -20 °C
- Informationen zur Lagerung
- After reconstitution, the CHRNA3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- CHRNA3 (Cholinergic Receptor, Nicotinic, alpha 3 (Neuronal) (CHRNA3))
- Andere Bezeichnung
- CHRNA3 (CHRNA3 Produkte)
- Synonyme
- LNCR2 antikoerper, NACHRA3 antikoerper, PAOD2 antikoerper, (a)3 antikoerper, A730007P14Rik antikoerper, Acra-3 antikoerper, Acra3 antikoerper, cholinergic receptor nicotinic alpha 3 subunit antikoerper, cholinergic receptor, nicotinic, alpha polypeptide 3 antikoerper, CHRNA3 antikoerper, Chrna3 antikoerper
- Hintergrund
- After binding acetylcholine, Nicotinic Acetylcholine Receptor alpha 3 (CHRNA3) responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. [UniProt]
- UniProt
- P32297
- Pathways
- Synaptic Membrane
-