DEFB4A Antikörper (AA 4-41)
-
- Target Alle DEFB4A (DEFB4) Antikörper anzeigen
- DEFB4A (DEFB4) (Defensin, beta 4A (DEFB4))
-
Bindungsspezifität
- AA 4-41
-
Reaktivität
- Human
-
Wirt
-
Schaf
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DEFB4A Antikörper ist unkonjugiert
-
Applikation
- ELISA, Radioimmunoassay (RIA)
- Spezifität
- Recognizes human beta-Defensin 2 (epitope: aa 4-41).
- Homologie
- Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla (100%) Gibbon, Monkey (97%) Orangutan (81%).
- Aufreinigung
- Protein G purified
- Immunogen
- Synthetic human -Defensin 2 (aa 4-41)(DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla (100%), Gibbon, Monkey (97%), Orangutan (81%).
- Isotyp
- IgG
- Top Product
- Discover our top product DEFB4 Primärantikörper
-
-
- Applikationshinweise
-
Approved: ELISA (1:5000), RIA
Usage: Suitable for use in ELISA and RIA. ELISA: 1:5000. - Kommentare
-
Target Species of Antibody: Human
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Sterile buffer or distilled water
- Konzentration
- Lot specific
- Buffer
- Lyophilized from 50 mM Tris, pH 7.4
- Lagerung
- -20 °C
- Informationen zur Lagerung
- Lyophilized powder may be stored at -20°C. Aliquot and store at -20°C. Reconstituted product is stable for 1 year at -20°C.
-
- Target
- DEFB4A (DEFB4) (Defensin, beta 4A (DEFB4))
- Andere Bezeichnung
- DEFB4A / DEFB2 (DEFB4 Produkte)
- Hintergrund
-
Name/Gene ID: DEFB4A
Synonyms: DEFB4A, Beta-defensin 2, Beta-defensin 4A, DEFB-2, DEFB102, Defensin, beta 2, Defensin, beta 4, Defensin, beta 4A, DEFB4, DEFB2, HBD-2, Skin-antimicrobial peptide 1, BD-2, SAP1 - Gen-ID
- 1673
-