RORA Antikörper (N-Term)
-
- Target Alle RORA Antikörper anzeigen
- RORA (RAR-Related Orphan Receptor A (RORA))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RORA Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RORA antibody was raised against the N terminal of RORA
- Aufreinigung
- Purified
- Immunogen
- RORA antibody was raised using the N terminal of RORA corresponding to a region with amino acids CGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRTSRNRC
- Top Product
- Discover our top product RORA Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RORA Blocking Peptide, catalog no. 33R-1692, is also available for use as a blocking control in assays to test for specificity of this RORA antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RORA antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RORA (RAR-Related Orphan Receptor A (RORA))
- Andere Bezeichnung
- RORA (RORA Produkte)
- Synonyme
- ror1 antikoerper, ror2 antikoerper, ror3 antikoerper, rzra antikoerper, nr1f1 antikoerper, MGC146531 antikoerper, NR1F1 antikoerper, ROR1 antikoerper, ROR2 antikoerper, ROR3 antikoerper, RZR-ALPHA antikoerper, RZRA antikoerper, RORalpha-B antikoerper, gb:dq017624 antikoerper, rora2 antikoerper, 9530021D13Rik antikoerper, Nr1f1 antikoerper, nmf267 antikoerper, sg antikoerper, staggerer antikoerper, tmgc26 antikoerper, RORalpha1 antikoerper, RAR related orphan receptor A antikoerper, RAR-related orphan receptor A antikoerper, RAR-related orphan receptor A, paralog a antikoerper, RAR-related orphan receptor alpha antikoerper, RORA antikoerper, rora antikoerper, Rora antikoerper, roraa antikoerper
- Hintergrund
- The protein encoded by RORA is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene.
- Molekulargewicht
- 62 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Regulation of Lipid Metabolism by PPARalpha
-