ECHDC3 Antikörper (N-Term)

Produktnummer ABIN629586

Produktdetails anti-ECHDC3 Antikörper

Target: ECHDC3 (Enoyl CoA Hydratase Domain Containing 3 (ECHDC3))

Bindungsspezifität: N-Term

Reaktivität: Ratte, Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ECHDC3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ECHDC3 antibody was raised against the N terminal of ECHDC3

Aufreinigung: Purified

Immunogen: ECHDC3 antibody was raised using the N terminal of ECHDC3 corresponding to a region with amino acids SLAMLKSLQSDILHDADSNDLKVIIISAEGPVFSSGHDLKELTEEQGRDY

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ECHDC3 Blocking Peptide, catalog no. 33R-8576, is also available for use as a blocking control in assays to test for specificity of this ECHDC3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ECHDC3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ECHDC3

Target: ECHDC3 (Enoyl CoA Hydratase Domain Containing 3 (ECHDC3))

Andere Bezeichnung: ECHDC3 (ECHDC3 Produkte)

Synonyme: 2310005D12Rik antikoerper, AI662097 antikoerper, echdc3 antikoerper, enoyl-CoA hydratase domain containing 3 antikoerper, enoyl CoA hydratase domain containing 3 antikoerper, enoyl-CoA hydratase domain containing 3 L homeolog antikoerper, enoyl Coenzyme A hydratase domain containing 3 antikoerper, ECHDC3 antikoerper, Echdc3 antikoerper, echdc3.L antikoerper, echdc3 antikoerper

Hintergrund: ECHDC3 possesses catalytic activity.

Molekulargewicht: 40 kDa (MW of target protein)