USP16 Antikörper (N-Term)
-
- Target Alle USP16 Antikörper anzeigen
- USP16 (Ubiquitin Specific Peptidase 16 (USP16))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser USP16 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- USP16 antibody was raised against the N terminal of USP16
- Aufreinigung
- Purified
- Immunogen
- USP16 antibody was raised using the N terminal of USP16 corresponding to a region with amino acids CKTDNKVKDKAEEETEEKPSVWLCLKCGHQGCGRNSQEQHALKHYLTPRS
- Top Product
- Discover our top product USP16 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
USP16 Blocking Peptide, catalog no. 33R-1726, is also available for use as a blocking control in assays to test for specificity of this USP16 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of USP16 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- USP16 (Ubiquitin Specific Peptidase 16 (USP16))
- Andere Bezeichnung
- USP16 (USP16 Produkte)
- Hintergrund
- USP16 is a deubiquitinating enzyme that is phosphorylated at the onset of mitosis and then dephosphorylated at the metaphase/anaphase transition. It can deubiquitinate H2A, one of two major ubiquitinated proteins of chromatin, in vitro and a mutant form of the protein was shown to block cell division.
- Molekulargewicht
- 44 kDa (MW of target protein)
-