METTL7A Antikörper (N-Term)

Produktnummer ABIN629594

Produktdetails anti-METTL7A Antikörper

Target: METTL7A (Methyltransferase Like 7A (METTL7A))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser METTL7A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: METTL7 A antibody was raised against the N terminal of METTL7

Aufreinigung: Purified

Immunogen: METTL7 A antibody was raised using the N terminal of METTL7 corresponding to a region with amino acids MASKKRELFSNLQEFAGPSGKLSLLEVGCGTGANFKFYPPGCRVTCIDPN

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

METTL7A Blocking Peptide, catalog no. 33R-5748, is also available for use as a blocking control in assays to test for specificity of this METTL7A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of METTL0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu METTL7A

Target: METTL7A (Methyltransferase Like 7A (METTL7A))

Andere Bezeichnung: METTL7A (METTL7A Produkte)

Synonyme: AAM-B antikoerper, 2210414H16Rik antikoerper, 3300001H21Rik antikoerper, Aam-B antikoerper, Mettl7a antikoerper, UbiE1 antikoerper, RGD1308407 antikoerper, MGC82719 antikoerper, zgc:153889 antikoerper, MGC145311 antikoerper, DKFZp459L026 antikoerper, methyltransferase like 7A antikoerper, methyltransferase like 7A1 antikoerper, methyltransferase like 7A L homeolog antikoerper, METTL7A antikoerper, Mettl7a1 antikoerper, Mettl7a antikoerper, mettl7a.L antikoerper, mettl7a antikoerper

Hintergrund: METTL7A is thought to be a methyltransferase enzyme.

Molekulargewicht: 20 kDa (MW of target protein)