CBS Antikörper (N-Term)
-
- Target Alle CBS Antikörper anzeigen
- CBS (Cystathionine-beta-Synthase (CBS))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CBS Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- CBS antibody was raised against the N terminal of CBS
- Aufreinigung
- Purified
- Immunogen
- CBS antibody was raised using the N terminal of CBS corresponding to a region with amino acids RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE
- Top Product
- Discover our top product CBS Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CBS Blocking Peptide, catalog no. 33R-7836, is also available for use as a blocking control in assays to test for specificity of this CBS antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CBS antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
Dysregulated Sulfide Metabolism in Multiple Sclerosis: Serum and Vascular Endothelial Inflammatory Responses." in: Pathophysiology : the official journal of the International Society for Pathophysiology, Vol. 29, Issue 3, pp. 570-582, (2022) (PubMed).
: "
-
Dysregulated Sulfide Metabolism in Multiple Sclerosis: Serum and Vascular Endothelial Inflammatory Responses." in: Pathophysiology : the official journal of the International Society for Pathophysiology, Vol. 29, Issue 3, pp. 570-582, (2022) (PubMed).
-
- Target
- CBS (Cystathionine-beta-Synthase (CBS))
- Andere Bezeichnung
- CBS (CBS Produkte)
- Synonyme
- hip4 antikoerper, GB12529 antikoerper, CBS antikoerper, DDBDRAFT_0189727 antikoerper, DDBDRAFT_0191292 antikoerper, DDB_0189727 antikoerper, DDB_0191292 antikoerper, cbs antikoerper, AI047524 antikoerper, AI303044 antikoerper, HIP4 antikoerper, cb442 antikoerper, wu:fb37g05 antikoerper, wu:fm61c07 antikoerper, wu:fq06c06 antikoerper, zgc:113704 antikoerper, cystathionine-beta-synthase L homeolog antikoerper, cystathionine-beta-synthase antikoerper, cystathionine beta-synthase antikoerper, cystathionine beta-synthase CBS antikoerper, cystathionine beta synthase antikoerper, cystathionine-beta-synthase S homeolog antikoerper, cystathionine-beta-synthase b antikoerper, cbs.L antikoerper, cbs antikoerper, Cbs antikoerper, CBS antikoerper, CNA06170 antikoerper, Tb11.02.5400 antikoerper, cysB antikoerper, LOC100635325 antikoerper, cbs.S antikoerper, cbsb antikoerper
- Hintergrund
- CBS is involved in the transsulfuration pathway. The first step of this pathway, from homocysteine to cystathionine, is catalyzed by this protein. CBS deficiency can cause homocystinuria which affects many organs and tissues, including the eyes and the skeletal, vascular and central nervous systems.
- Molekulargewicht
- 60 kDa (MW of target protein)
-