CBS Antikörper (N-Term)
(1 reference)-
- Target Alle CBS Antikörper anzeigen
- CBS (Cystathionine-beta-Synthase (CBS))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CBS Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- CBS antibody was raised against the N terminal of CBS
- Aufreinigung
- Purified
- Immunogen
- CBS antibody was raised using the N terminal of CBS corresponding to a region with amino acids RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE
- Top Product
- Discover our top product CBS Primärantikörper
-
anti-Cystathionine-beta-Synthase (CBS) (AA 1-100) antibody
CBS Reaktivität: Human WB, ELISA, IHC (p), IP, RNAi Wirt: Maus Monoclonal 3E1 unconjugated
anti-Cystathionine-beta-Synthase (CBS) (AA 252-551) antibodyCBS Reaktivität: Human WB, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Cystathionine-beta-Synthase (CBS) (AA 301-330) antibodyCBS Reaktivität: Human, Maus, Ratte WB, IF, IHC (p), FACS Wirt: Kaninchen Polyclonal RB21183 unconjugated
anti-Cystathionine-beta-Synthase (CBS) (AA 104-133), (N-Term) antibodyCBS Reaktivität: Human, Maus WB, IF, IHC (p), FACS Wirt: Kaninchen Polyclonal RB22961 unconjugated
anti-Cystathionine-beta-Synthase (CBS) (AA 1-100) antibodyCBS Reaktivität: Human WB, ELISA, IF, IHC (p) Wirt: Maus Monoclonal 6A9 unconjugated
anti-Cystathionine-beta-Synthase (CBS) (N-Term) antibodyCBS Reaktivität: Human, Maus, Ratte, Hund, Rind (Kuh), Meerschweinchen, Pferd, Kaninchen, Saccharomyces cerevisiae, Zebrafisch (Danio rerio) WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Cystathionine-beta-Synthase (CBS) (AA 1-413) antibodyCBS Reaktivität: Human WB, ELISA, IHC, IF, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Cystathionine-beta-Synthase (CBS) antibodyKO Validated CBS Reaktivität: Human WB, IF, IHC (p), IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Cystathionine-beta-Synthase (CBS) antibodyCBS Reaktivität: Human WB, IHC, IF Wirt: Kaninchen Monoclonal unconjugated
anti-Cystathionine-beta-Synthase (CBS) (AA 1-551) antibodyCBS Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CBS Blocking Peptide, catalog no. 33R-7836, is also available for use as a blocking control in assays to test for specificity of this CBS antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CBS antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
: "Dysregulated Sulfide Metabolism in Multiple Sclerosis: Serum and Vascular Endothelial Inflammatory Responses." in: Pathophysiology : the official journal of the International Society for Pathophysiology, Vol. 29, Issue 3, pp. 570-582, (2022) (PubMed).
-
: "Dysregulated Sulfide Metabolism in Multiple Sclerosis: Serum and Vascular Endothelial Inflammatory Responses." in: Pathophysiology : the official journal of the International Society for Pathophysiology, Vol. 29, Issue 3, pp. 570-582, (2022) (PubMed).
-
- Target
- CBS (Cystathionine-beta-Synthase (CBS))
- Andere Bezeichnung
- CBS (CBS Produkte)
- Hintergrund
- CBS is involved in the transsulfuration pathway. The first step of this pathway, from homocysteine to cystathionine, is catalyzed by this protein. CBS deficiency can cause homocystinuria which affects many organs and tissues, including the eyes and the skeletal, vascular and central nervous systems.
- Molekulargewicht
- 60 kDa (MW of target protein)
-
