eEF1A1 Antikörper (C-Term)

Produktnummer ABIN629602

Produktdetails anti-eEF1A1 Antikörper

Target: eEF1A1 (EEF1A1) (Eukaryotic Translation Elongation Factor 1 alpha 1 (EEF1A1))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser eEF1A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EEF1 A1 antibody was raised against the C terminal of EEF1 1

Aufreinigung: Purified

Immunogen: EEF1 A1 antibody was raised using the C terminal of EEF1 1 corresponding to a region with amino acids IVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGK

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EEF1A1 Blocking Peptide, catalog no. 33R-4196, is also available for use as a blocking control in assays to test for specificity of this EEF1A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EEF0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu eEF1A1

Target: eEF1A1 (EEF1A1) (Eukaryotic Translation Elongation Factor 1 alpha 1 (EEF1A1))

Andere Bezeichnung: EEF1A1 (EEF1A1 Produkte)

Hintergrund: EEF1A1 is an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas, and the other isoform (alpha 2) is expressed in brain, heart and skeletal muscle. This isoform is identified as an autoantigen in 66% of patients with Felty syndrome.

Molekulargewicht: 50 kDa (MW of target protein)