eEF1A1 Antikörper (C-Term)
-
- Target Alle eEF1A1 (EEF1A1) Antikörper anzeigen
- eEF1A1 (EEF1A1) (Eukaryotic Translation Elongation Factor 1 alpha 1 (EEF1A1))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser eEF1A1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- EEF1 A1 antibody was raised against the C terminal of EEF1 1
- Aufreinigung
- Purified
- Immunogen
- EEF1 A1 antibody was raised using the C terminal of EEF1 1 corresponding to a region with amino acids IVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGK
- Top Product
- Discover our top product EEF1A1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EEF1A1 Blocking Peptide, catalog no. 33R-4196, is also available for use as a blocking control in assays to test for specificity of this EEF1A1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EEF0 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- eEF1A1 (EEF1A1) (Eukaryotic Translation Elongation Factor 1 alpha 1 (EEF1A1))
- Andere Bezeichnung
- EEF1A1 (EEF1A1 Produkte)
- Synonyme
- CCS-3 antikoerper, CCS3 antikoerper, EE1A1 antikoerper, EEF-1 antikoerper, EEF1A antikoerper, EF-Tu antikoerper, EF1A antikoerper, GRAF-1EF antikoerper, HNGC:16303 antikoerper, LENG7 antikoerper, PTI1 antikoerper, eEF1A-1 antikoerper, Eef1a2 antikoerper, Eef1a2l1 antikoerper, SI antikoerper, EEF1A2 antikoerper, EF1A1 antikoerper, eef1a1 antikoerper, wu:fj34g08 antikoerper, zgc:110335 antikoerper, EEF1A1 antikoerper, RABEFLA2 antikoerper, EFL1-alpha antikoerper, chunp6927 antikoerper, eef1a antikoerper, ef1a antikoerper, ik:tdsubc_2a3 antikoerper, ik:tdsubc_2b3 antikoerper, tdsubc_2a3 antikoerper, wu:fa91c07 antikoerper, wu:fa94b03 antikoerper, wu:fi13b09 antikoerper, xx:tdsubc_2a3 antikoerper, xx:tdsubc_2b3 antikoerper, EF-1A antikoerper, EF-1-ALPHA-S antikoerper, eef1a-s antikoerper, eef1as antikoerper, fj64c02 antikoerper, wu:fj64c02 antikoerper, zgc:73138 antikoerper, eukaryotic translation elongation factor 1 alpha 1 antikoerper, eukaryotic translation elongation factor 1 alpha 1b antikoerper, eukaryotic translation elongation factor 1 alpha 1, like 1 antikoerper, eukaryotic translation elongation factor 1 alpha 1 L homeolog antikoerper, elongation factor 1-alpha antikoerper, eukaryotic translation elongation factor 1 alpha 1a antikoerper, EEF1A1 antikoerper, Eef1a1 antikoerper, eef1a1b antikoerper, eef1a1l1 antikoerper, eef1a1.L antikoerper, tufA antikoerper, eef1a1a antikoerper
- Hintergrund
- EEF1A1 is an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas, and the other isoform (alpha 2) is expressed in brain, heart and skeletal muscle. This isoform is identified as an autoantigen in 66% of patients with Felty syndrome.
- Molekulargewicht
- 50 kDa (MW of target protein)
-