PRMT5 Antikörper (N-Term)

Produktnummer ABIN629605

Produktdetails anti-PRMT5 Antikörper

Target: PRMT5 (Protein Arginine Methyltransferase 5 (PRMT5))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRMT5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: PRMT5 antibody was raised against the N terminal of PRMT5

Aufreinigung: Purified

Immunogen: PRMT5 antibody was raised using the N terminal of PRMT5 corresponding to a region with amino acids FDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLS

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRMT5 Blocking Peptide, catalog no. 33R-2864, is also available for use as a blocking control in assays to test for specificity of this PRMT5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRMT5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PRMT5

Target: PRMT5 (Protein Arginine Methyltransferase 5 (PRMT5))

Andere Bezeichnung: PRMT5 (PRMT5 Produkte)

Synonyme: HRMT1L5 antikoerper, IBP72 antikoerper, JBP1 antikoerper, SKB1 antikoerper, SKB1Hs antikoerper, Jbp1 antikoerper, Skb1 antikoerper, si:zc14a17.2 antikoerper, skb1 antikoerper, wu:fb95f10 antikoerper, zgc:110669 antikoerper, hsl7 antikoerper, DDBDRAFT_0187422 antikoerper, DDBDRAFT_0235403 antikoerper, DDB_0187422 antikoerper, DDB_0235403 antikoerper, NV18830 antikoerper, jbp1 antikoerper, ibp72 antikoerper, skb1hs antikoerper, hrmt1l5 antikoerper, protein arginine methyltransferase 5 antikoerper, protein arginine N-methyltransferase 5 antikoerper, protein arginine methyltransferase 5 L homeolog antikoerper, putative arginine N-methyltransferase, type II antikoerper, Skb1 family protein antikoerper, Protein arginine N-methyltransferase 5 antikoerper, PRMT5 antikoerper, Prmt5 antikoerper, prmt5 antikoerper, prmt5.L antikoerper, LOC100115766 antikoerper, prmt-5 antikoerper

Hintergrund: PRMT5 methylates specific arginine residues in the small nuclear ribonucleoproteins Sm D1 and Sm D3 to monomethylarginine and to symmetrical dimethylarginines (sDMAs). It methylates SUPT5H. PRMT5 plays a role in the assembly of snRNP core particles and may play a role in cytokine-activated transduction pathways. It negatively regulates cyclin E1 promoter activity and cellular proliferation and May regulate the SUPT5H transcriptional elongation properties. It may be part of a pathway that is connected to a chloride current, possibly through cytoskeletal rearrangement. PRMT5 methylates histone H2A/H4 'Arg-3' during germ cell development and methylates histone H3 'Arg-8', which may repress transcription.

Molekulargewicht: 68 kDa (MW of target protein)

Pathways: Chromatin Binding, Regulation of Muscle Cell Differentiation, Ribonucleoprotein Complex Subunit Organization, Skeletal Muscle Fiber Development