BMP2K Antikörper (C-Term)
-
- Target Alle BMP2K Antikörper anzeigen
- BMP2K (BMP2 Inducible Kinase (BMP2K))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser BMP2K Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- BMP2 K antibody was raised against the C terminal of BMP2
- Aufreinigung
- Purified
- Immunogen
- BMP2 K antibody was raised using the C terminal of BMP2 corresponding to a region with amino acids AQHQPSQQQASPEYLTSPQEFSPALVSYTSSLPAQVGTIMDSSYSANRSV
- Top Product
- Discover our top product BMP2K Primärantikörper
-
-
- Applikationshinweise
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
BMP2K Blocking Peptide, catalog no. 33R-1448, is also available for use as a blocking control in assays to test for specificity of this BMP2K antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BMP0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BMP2K (BMP2 Inducible Kinase (BMP2K))
- Andere Bezeichnung
- BMP2K (BMP2K Produkte)
- Synonyme
- zgc:101641 antikoerper, BIKE antikoerper, 4933417M22Rik antikoerper, AA673486 antikoerper, AV128808 antikoerper, BMP2 inducible kinase antikoerper, BMP-2 inducible kinase antikoerper, BMP2K antikoerper, bmp2k antikoerper, Bmp2k antikoerper
- Hintergrund
- BMP2K is the human homolog of mouse BMP-2-inducible kinase. Bone morphogenic proteins (BMPs) play a key role in skeletal development and patterning. BMP2K is thought to be a protein kinase with a putative regulatory role in attenuating the program of osteoblast differentiation. This gene is the human homolog of mouse BMP-2-inducible kinase. Bone morphogenic proteins (BMPs) play a key role in skeletal development and patterning.
- Molekulargewicht
- 74 kDa (MW of target protein)
-