CENPA Antikörper (N-Term)
-
- Target Alle CENPA Antikörper anzeigen
- CENPA (Centromere Protein A (CENPA))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CENPA Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- CENPA antibody was raised against the N terminal of CENPA
- Aufreinigung
- Purified
- Immunogen
- CENPA antibody was raised using the N terminal of CENPA corresponding to a region with amino acids MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKE
- Top Product
- Discover our top product CENPA Primärantikörper
-
anti-Centromere Protein A (CENPA) (pSer16), (pSer18) antibody
CENPA Reaktivität: Human WB, IF, ICC, DB Wirt: Kaninchen Polyclonal unconjugated
anti-Centromere Protein A (CENPA) (AA 65-140) antibodyCENPA Reaktivität: Human WB, ELISA, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Centromere Protein A (CENPA) antibodyCENPA Reaktivität: Human WB, IF, ICC Wirt: Maus Monoclonal 5A7-2E11 unconjugated
anti-Centromere Protein A (CENPA) antibody (HRP)CENPA Reaktivität: Human WB, IF, ICC Wirt: Maus Monoclonal 5A7-2E11 HRP
anti-Centromere Protein A (CENPA) antibody (FITC)CENPA Reaktivität: Human WB, IF, ICC Wirt: Maus Monoclonal 5A7-2E11 FITC
anti-Centromere Protein A (CENPA) antibody (Biotin)CENPA Reaktivität: Human WB, IF, ICC Wirt: Maus Monoclonal 5A7-2E11 Biotin
anti-Centromere Protein A (CENPA) antibody (PE)CENPA Reaktivität: Human WB, IF, ICC Wirt: Maus Monoclonal 5A7-2E11 PE
anti-Centromere Protein A (CENPA) antibody (APC)CENPA Reaktivität: Human WB, IF, ICC Wirt: Maus Monoclonal 5A7-2E11 APC
anti-Centromere Protein A (CENPA) antibody (PerCP)CENPA Reaktivität: Human WB, IF, ICC Wirt: Maus Monoclonal 5A7-2E11 PerCP
anti-Centromere Protein A (CENPA) antibody (Atto 488)CENPA Reaktivität: Human WB, IF, ICC Wirt: Maus Monoclonal 5A7-2E11 Atto 488
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CENPA Blocking Peptide, catalog no. 33R-6060, is also available for use as a blocking control in assays to test for specificity of this CENPA antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CENPA antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CENPA (Centromere Protein A (CENPA))
- Andere Bezeichnung
- CENPA (CENPA Produkte)
- Synonyme
- CENP-A antikoerper, CenH3 antikoerper, Cenp-A antikoerper, cenpx antikoerper, cenp-a antikoerper, sim2 antikoerper, Cenp-a antikoerper, RGD1563607 antikoerper, CENPA antikoerper, centromere protein A antikoerper, centromere protein-A antikoerper, centromeric histone-3 like protein antikoerper, centromere-specific histone H3 CENP-A antikoerper, cenp-A antikoerper, centromere protein A L homeolog antikoerper, histone H3-like centromeric protein A antikoerper, CENPA antikoerper, Cenpa antikoerper, CENP-A antikoerper, cenpa antikoerper, cenp-A antikoerper, cnp1 antikoerper, HAN_3g422 antikoerper, Cenp-a antikoerper, cenpa.L antikoerper, CMU_016480 antikoerper
- Hintergrund
- Centromeres are the differentiated chromosomal domains that specify the mitotic behavior of chromosomes. CENPA is a centromere protein which contains a histone H3 related histone fold domain that is required for targeting to the centromere. CENPA is proposed to be a component of a modified nucleosome or nucleosome-like structure in which it replaces 1 or both copies of conventional histone H3 in the (H3-H4)2 tetrameric core of the nucleosome particle.
- Molekulargewicht
- 16 kDa (MW of target protein)
- Pathways
- Chromatin Binding, Maintenance of Protein Location
-
