PEBP1 Antikörper (C-Term)
-
- Target Alle PEBP1 Antikörper anzeigen
- PEBP1 (Phosphatidylethanolamine Binding Protein 1 (PEBP1))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PEBP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PEBP1 antibody was raised against the C terminal of PEBP1
- Aufreinigung
- Purified
- Immunogen
- PEBP1 antibody was raised using the C terminal of PEBP1 corresponding to a region with amino acids LSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK
- Top Product
- Discover our top product PEBP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PEBP1 Blocking Peptide, catalog no. 33R-5442, is also available for use as a blocking control in assays to test for specificity of this PEBP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEBP1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PEBP1 (Phosphatidylethanolamine Binding Protein 1 (PEBP1))
- Andere Bezeichnung
- PEBP1 (PEBP1 Produkte)
- Synonyme
- HCNP antikoerper, HCNPpp antikoerper, PBP antikoerper, PEBP antikoerper, PEBP-1 antikoerper, RKIP antikoerper, pbp antikoerper, hcnp antikoerper, pebp antikoerper, rkip antikoerper, Pbp antikoerper, Pbp1 antikoerper, Pbpr antikoerper, Rkip antikoerper, PEBP1 antikoerper, BcDNA:LP12095 antikoerper, CG18594 antikoerper, Dmel\\CG18594 antikoerper, T2 antikoerper, zgc:56033 antikoerper, zgc:76942 antikoerper, phosphatidylethanolamine binding protein 1 antikoerper, phosphatidylethanolamine binding protein 1 L homeolog antikoerper, phosphatidylethanolamine-binding protein antikoerper, phosphatidylethanolamine-binding protein,putative antikoerper, Phosphatidylethanolamine-binding protein 1 antikoerper, PEBP1 antikoerper, pebp1 antikoerper, Pebp1 antikoerper, pebp1.L antikoerper, RR_RS07785 antikoerper, PVX_235290 antikoerper, PVX_123630 antikoerper, PKH_143640 antikoerper, EAM_1207 antikoerper
- Hintergrund
- PEBP1 binds ATP, opioids and phosphatidylethanolamine. It has lower affinity for phosphatidylinositol and phosphatidylcholine. It is also a serine protease inhibitor which inhibits thrombin, neuropsin and chymotrypsin but not trypsin, tissue type plasminogen activator and elastase.
- Molekulargewicht
- 21 kDa (MW of target protein)
- Pathways
- Feeding Behaviour
-