PRMT2 Antikörper (N-Term)

Produktnummer ABIN629611

Produktdetails anti-PRMT2 Antikörper

Target: PRMT2 (Protein Arginine Methyltransferase 2 (PRMT2))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRMT2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: PRMT2 antibody was raised against the N terminal of PRMT2

Aufreinigung: Purified

Immunogen: PRMT2 antibody was raised using the N terminal of PRMT2 corresponding to a region with amino acids ESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILIL

Anwendungsinformationen

Applikationshinweise: WB: 0.625 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRMT2 Blocking Peptide, catalog no. 33R-2742, is also available for use as a blocking control in assays to test for specificity of this PRMT2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRMT2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PRMT2

Target: PRMT2 (Protein Arginine Methyltransferase 2 (PRMT2))

Andere Bezeichnung: PRMT2 (PRMT2 Produkte)

Synonyme: PRMT2 antikoerper, DKFZp459N1919 antikoerper, HRMT1L1 antikoerper, Hrmt1l1 antikoerper, AI504737 antikoerper, protein arginine methyltransferase 2 antikoerper, protein arginine methyltransferase 2 L homeolog antikoerper, protein arginine N-methyltransferase 2 antikoerper, PRMT2 antikoerper, Prmt2 antikoerper, prmt2.L antikoerper

Hintergrund: The protein arginine methyltransferases (PRMTs) include a family of proteins with related putative methyltransferase domains that modify chromatin and regulate cellular transcription. PRMT2 inhibits NF-kappaB-dependent transcription and promotes apoptosis and it exerts this effect by blocking nuclear export of IkappaB-alpha through a leptomycin-sensitive pathway, increasing nuclear IkappaB-alpha and decreasing NF-kappaB DNA binding. PRMT2 also rendered cells susceptible to apoptosis by cytokines or cytotoxic drugs, likely due to its effects on NF-kappaB.

Molekulargewicht: 48 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Nuclear Hormone Receptor Binding