PARP6 Antikörper
-
- Target Alle PARP6 Produkte
- PARP6 (Poly (ADP-Ribose) Polymerase Family, Member 6 (PARP6))
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PARP6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- PARP6 antibody was raised using a synthetic peptide corresponding to a region with amino acids HINISFLDEEVSTAWKVLRTEPIVLRLRFSLSQYLDGPEPSIEVFQPSNK
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PARP6 Blocking Peptide, catalog no. 33R-3755, is also available for use as a blocking control in assays to test for specificity of this PARP6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARP6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PARP6 (Poly (ADP-Ribose) Polymerase Family, Member 6 (PARP6))
- Andere Bezeichnung
- PARP6 (PARP6 Produkte)
- Synonyme
- ARTD17 antikoerper, PARP-6-B1 antikoerper, PARP-6-C antikoerper, pART17 antikoerper, 1700119G14Rik antikoerper, 2310028P13Rik antikoerper, 3110038K10Rik antikoerper, C030013N01Rik antikoerper, PARP-6 antikoerper, RGD1310937 antikoerper, zgc:92798 antikoerper, poly(ADP-ribose) polymerase family member 6 antikoerper, poly (ADP-ribose) polymerase family, member 6 antikoerper, poly(ADP-ribose) polymerase family member 6 S homeolog antikoerper, poly [ADP-ribose] polymerase 6 antikoerper, poly (ADP-ribose) polymerase family, member 6a antikoerper, PARP6 antikoerper, Parp6 antikoerper, parp6 antikoerper, parp6.S antikoerper, LOC100475149 antikoerper, parp6a antikoerper
- Hintergrund
- Poly(ADP-ribose) polymerases (PARPs) constitute a large family of 18 proteins, encoded by different genes and displaying a conserved catalytic domain. They are involved in DNA-damage-dependent post-translational modification of histones and other nuclear proteins that contributes to the survival of injured proliferating cells.
- Molekulargewicht
- 59 kDa (MW of target protein)
-