PEX3 Antikörper (N-Term)
-
- Target Alle PEX3 Antikörper anzeigen
- PEX3 (Peroxisomal Biogenesis Factor 3 (PEX3))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PEX3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- PEX3 antibody was raised against the N terminal of PEX3
- Aufreinigung
- Purified
- Immunogen
- PEX3 antibody was raised using the N terminal of PEX3 corresponding to a region with amino acids KYGQKKIREIQEREAAEYIAQARRQYHFESNQRTCNMTVLSMLPTLREAL
- Top Product
- Discover our top product PEX3 Primärantikörper
-
anti-Peroxisomal Biogenesis Factor 3 (PEX3) antibody
PEX3 Reaktivität: Human, Maus, Ratte IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Peroxisomal Biogenesis Factor 3 (PEX3) (N-Term) antibodyPEX3 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Pferd, Kaninchen, Zebrafisch (Danio rerio) WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Peroxisomal Biogenesis Factor 3 (PEX3) (AA 144-373) antibodyPEX3 Reaktivität: Human WB, IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Peroxisomal Biogenesis Factor 3 (PEX3) (AA 31-80) antibodyPEX3 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Affe, Meerschweinchen, Pferd, Kaninchen, Fledermaus, Huhn, Hamster, Schwein, Xenopus laevis WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Peroxisomal Biogenesis Factor 3 (PEX3) (N-Term) antibodyPEX3 Reaktivität: Human WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Peroxisomal Biogenesis Factor 3 (PEX3) (N-Term) antibodyPEX3 Reaktivität: Human, Maus, Ratte WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Peroxisomal Biogenesis Factor 3 (PEX3) (AA 1-373) antibodyPEX3 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Peroxisomal Biogenesis Factor 3 (PEX3) (AA 271-373) antibodyPEX3 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 3C2 unconjugated
anti-Peroxisomal Biogenesis Factor 3 (PEX3) (N-Term) antibodyPEX3 Reaktivität: Human, Maus, Ratte WB, ELISA, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PEX3 Blocking Peptide, catalog no. 33R-4740, is also available for use as a blocking control in assays to test for specificity of this PEX3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEX3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PEX3 (Peroxisomal Biogenesis Factor 3 (PEX3))
- Andere Bezeichnung
- PEX3 (PEX3 Produkte)
- Synonyme
- DDBDRAFT_0204086 antikoerper, DDBDRAFT_0238047 antikoerper, DDB_0204086 antikoerper, DDB_0238047 antikoerper, zgc:56313 antikoerper, PBD10A antikoerper, TRG18 antikoerper, Peroxin-3 antikoerper, 1700014F15Rik antikoerper, 2810027F19Rik antikoerper, 2900010N04Rik antikoerper, peroxisomal biogenesis factor 3 antikoerper, peroxin 3 antikoerper, peroxisomal biogenesis factor 3 L homeolog antikoerper, LOC692959 antikoerper, CpipJ_CPIJ013204 antikoerper, pex3 antikoerper, PEX3 antikoerper, pex3.L antikoerper, Pex3 antikoerper
- Hintergrund
- PEX3 is involved in peroxisome biosynthesis and integrity. It assembles membrane vesicles before the matrix proteins are translocated. As a docking factor for PEX19, it is necessary for the import of peroxisomal membrane proteins in the peroxisomes.
- Molekulargewicht
- 42 kDa (MW of target protein)
-
