SWAP70 Antikörper (N-Term)

Produktnummer ABIN629614

Produktdetails anti-SWAP70 Antikörper

Target: SWAP70 (SWAP Switching B-Cell Complex 70kDa Subunit (SWAP70))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SWAP70 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SWAP70 antibody was raised against the N terminal of SWAP70

Aufreinigung: Purified

Immunogen: SWAP70 antibody was raised using the N terminal of SWAP70 corresponding to a region with amino acids ALEEHFRDDDEGPVSNQGYMPYLNRFILEKVQDNFDKIEFNRMCWTLCVK

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SWAP70 Blocking Peptide, catalog no. 33R-1326, is also available for use as a blocking control in assays to test for specificity of this SWAP70 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SWAP70 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SWAP70

Target: SWAP70 (SWAP Switching B-Cell Complex 70kDa Subunit (SWAP70))

Andere Bezeichnung: SWAP70 (SWAP70 Produkte)

Synonyme: SWAP-70 antikoerper, 70kDa antikoerper, AV235546 antikoerper, HSPC321 antikoerper, swap70b antikoerper, zgc:63599 antikoerper, switching B-cell complex subunit SWAP70 antikoerper, SWA-70 protein antikoerper, SWAP switching B-cell complex 70 antikoerper, SWAP switching B-cell complex 70kDa subunit antikoerper, switching B-cell complex subunit SWAP70a antikoerper, SWAP70 antikoerper, Swap70 antikoerper, swap70 antikoerper, swap70a antikoerper

Hintergrund: Phosphatidylinositol 3,4,5-trisphosphate-dependent guanine nucleotide exchange factor (GEF) which, independently of RAS, transduces signals from tyrosine kinase receptors to RAC. SWAP70 also mediates signaling of membrane ruffling. It regulates the actin cytoskeleton as an effector or adapter protein in response to agonist stimulated phosphatidylinositol (3,4)-bisphosphate production and cell protrusion.

Molekulargewicht: 69 kDa (MW of target protein)

Pathways: Production of Molecular Mediator of Immune Response