CDY1 Antikörper (C-Term)

Produktnummer ABIN629620

Produktdetails anti-CDY1 Antikörper

Target: CDY1 (Chromodomain Protein, Y-Linked, 1 (CDY1))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CDY1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CDY1 antibody was raised against the C terminal of CDY1

Aufreinigung: Purified

Immunogen: CDY1 antibody was raised using the C terminal of CDY1 corresponding to a region with amino acids FPRTWWQSAEDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDF

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CDY1 Blocking Peptide, catalog no. 33R-3023, is also available for use as a blocking control in assays to test for specificity of this CDY1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDY1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CDY1

Target: CDY1 (Chromodomain Protein, Y-Linked, 1 (CDY1))

Andere Bezeichnung: CDY1 (CDY1 Produkte)

Synonyme: CDY antikoerper, CDY1A antikoerper, chromodomain Y-linked 1 antikoerper, CDY1 antikoerper

Hintergrund: CDY1 containing a chromodomain and a histone acetyltransferase catalytic domain. Chromodomain proteins are components of heterochromatin-like complexes and can act as gene repressors. Histone hyperacetylation is thought to facilitate the transition in which protamines replace histones as the major DNA-packaging protein.

Molekulargewicht: 62 kDa (MW of target protein)