PRP19 Antikörper
-
- Target Alle PRP19 (PRPF19) Antikörper anzeigen
- PRP19 (PRPF19) (Pre-mRNA Processing Factor 19 (PRPF19))
-
Reaktivität
- Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PRP19 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Purified
- Immunogen
- PRPF19 antibody was raised using a synthetic peptide corresponding to a region with amino acids PSVVGAGEPMDLGELVGMTPEIIQKLQDKATVLTTERKKRGKTVPEELVK
- Top Product
- Discover our top product PRPF19 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PRPF19 Blocking Peptide, catalog no. 33R-7381, is also available for use as a blocking control in assays to test for specificity of this PRPF19 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRPF19 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRP19 (PRPF19) (Pre-mRNA Processing Factor 19 (PRPF19))
- Andere Bezeichnung
- PRPF19 (PRPF19 Produkte)
- Hintergrund
- PRPF19 plays a role in DNA double-strand break (DSB) repair and pre-mRNA splicing reaction. It binds double-stranded DNA in a sequence-nonspecific manner. PRPF19 acts as a structural component of the nuclear framework. It may also serve as a support for spliceosome binding and activity. It is essential for spliceosome assembly in a oligomerization-dependent manner and might also be important for spliceosome stability. It also may have E3 ubiquitin ligase activity.
- Molekulargewicht
- 55 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization
-