Deoxyuridine Triphosphatase (DUT) (C-Term) Antikörper

Produktnummer ABIN629626

Produktdetails

Target: Deoxyuridine Triphosphatase (DUT)

Bindungsspezifität: C-Term

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: DUT antibody was raised against the C terminal of DUT

Aufreinigung: Purified

Immunogen: DUT antibody was raised using the C terminal of DUT corresponding to a region with amino acids NFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DUT Blocking Peptide, catalog no. 33R-6682, is also available for use as a blocking control in assays to test for specificity of this DUT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DUT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: Deoxyuridine Triphosphatase (DUT)

Andere Bezeichnung: DUT (DUT Produkte)

Substanzklasse: Viral Protein

Hintergrund: DUT is an essential enzyme of nucleotide metabolism. This protein forms a ubiquitous, homotetrameric enzyme that hydrolyzes dUTP to dUMP and pyrophosphate. This reaction serves two cellular purposes: providing a precursor (dUMP) for the synthesis of thymine nucleotides needed for DNA replication, and limiting intracellular pools of dUTP. Elevated levels of dUTP lead to increased incorporation of uracil into DNA, which induces extensive excision repair mediated by uracil glycosylase. This repair process, resulting in the removal and reincorporation of dUTP, is self-defeating and leads to DNA fragmentation and cell death.

Molekulargewicht: 19 kDa (MW of target protein)