ZNF19 Antikörper (C-Term)

Produktnummer ABIN629628

Produktdetails anti-ZNF19 Antikörper

Target: ZNF19 (Zinc Finger Protein 19 (ZNF19))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ZNF19 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ZNF19 antibody was raised against the C terminal of ZNF19

Aufreinigung: Purified

Immunogen: ZNF19 antibody was raised using the C terminal of ZNF19 corresponding to a region with amino acids HQHQRIHTGEKPYECSKYEKAFGTSSQLGHLEHVYSGEKPVLDICRFGLP

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ZNF19 Blocking Peptide, catalog no. 33R-3824, is also available for use as a blocking control in assays to test for specificity of this ZNF19 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZNF19 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ZNF19

Target: ZNF19 (Zinc Finger Protein 19 (ZNF19))

Andere Bezeichnung: ZNF19 (ZNF19 Produkte)

Synonyme: KOX12 antikoerper, zinc finger protein 19 antikoerper, ZNF19 antikoerper

Hintergrund: ZNF19 contains a zinc finger, a nucleic acid-binding domain present in many transcription factors.

Molekulargewicht: 52 kDa (MW of target protein)