WDR12 Antikörper (C-Term)
-
- Target Alle WDR12 Antikörper anzeigen
- WDR12 (WD Repeat Domain 12 (WDR12))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser WDR12 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- WDR12 antibody was raised against the C terminal of WDR12
- Aufreinigung
- Purified
- Immunogen
- WDR12 antibody was raised using the C terminal of WDR12 corresponding to a region with amino acids DTRSCKAPLYDLAAHEDKVLSVDWTDTGLLLSGGADNKLYSYRYSPTTSH
- Top Product
- Discover our top product WDR12 Primärantikörper
-
anti-WD Repeat Domain 12 (WDR12) (AA 210-239) antibody
WDR12 Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal RB33036 unconjugated
anti-WD Repeat Domain 12 (WDR12) (C-Term) antibodyWDR12 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Meerschweinchen, Pferd, Kaninchen, Hund, Zebrafisch (Danio rerio) WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-WD Repeat Domain 12 (WDR12) (AA 1-280) antibodyWDR12 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-WD Repeat Domain 12 (WDR12) (C-Term) antibodyWDR12 Reaktivität: Human, Ratte, Rind (Kuh), Meerschweinchen, Pferd, Kaninchen, Hund, Schwein, Fledermaus, Hamster, Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-WD Repeat Domain 12 (WDR12) (AA 200-249) antibodyWDR12 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Meerschweinchen, Pferd, Kaninchen, Schwein, Zebrafisch (Danio rerio), Fledermaus, Hamster, Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-WD Repeat Domain 12 (WDR12) (Middle Region) antibodyWDR12 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Meerschweinchen, Pferd, Kaninchen, Hund, Zebrafisch (Danio rerio), Saccharomyces cerevisiae WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
WDR12 Blocking Peptide, catalog no. 33R-2209, is also available for use as a blocking control in assays to test for specificity of this WDR12 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR12 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- WDR12 (WD Repeat Domain 12 (WDR12))
- Andere Bezeichnung
- WDR12 (WDR12 Produkte)
- Synonyme
- WDR12 antikoerper, YTM1 antikoerper, 4933402C23Rik antikoerper, Ytm1 antikoerper, Ytm1p antikoerper, fb24f09 antikoerper, wu:fb24f09 antikoerper, zgc:55609 antikoerper, WD repeat domain 12 antikoerper, WDR12 antikoerper, Wdr12 antikoerper, wdr12 antikoerper
- Hintergrund
- WDR12 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. The function of this protein is not known.
- Molekulargewicht
- 47 kDa (MW of target protein)
-
