CACYBP Antikörper (Middle Region)
-
- Target Alle CACYBP Antikörper anzeigen
- CACYBP (Calcyclin Binding Protein (CACYBP))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CACYBP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CACYBP antibody was raised against the middle region of CACYBP
- Aufreinigung
- Purified
- Immunogen
- CACYBP antibody was raised using the middle region of CACYBP corresponding to a region with amino acids FTERSFDLLVKNLNGKSYSMIVNNLLKPISVEGSSKKVKTDTVLILCRKK
- Top Product
- Discover our top product CACYBP Primärantikörper
-
anti-Calcyclin Binding Protein (CACYBP) (AA 2-228) antibody
CACYBP Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Calcyclin Binding Protein (CACYBP) (C-Term) antibodyCACYBP Reaktivität: Human, Maus, Ratte WB, ELISA, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Calcyclin Binding Protein (CACYBP) (AA 2-228) antibodyCACYBP Reaktivität: Human WB, ELISA, IHC, IF, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Calcyclin Binding Protein (CACYBP) (AA 1-228) antibodyCACYBP Reaktivität: Human WB, ELISA, PLA Wirt: Maus Monoclonal 2E3 unconjugated
anti-Calcyclin Binding Protein (CACYBP) (AA 1-228) antibodyCACYBP Reaktivität: Human WB, IF Wirt: Maus Polyclonal unconjugated
anti-Calcyclin Binding Protein (CACYBP) antibodyCACYBP Reaktivität: Human, Maus, Ratte WB, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Calcyclin Binding Protein (CACYBP) (C-Term) antibodyCACYBP Reaktivität: Human WB, IF, ICC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Calcyclin Binding Protein (CACYBP) (AA 1-228) antibodyCACYBP Reaktivität: Human WB, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Calcyclin Binding Protein (CACYBP) (AA 7-47), (N-Term) antibodyCACYBP Reaktivität: Human, Maus, Ratte WB, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Calcyclin Binding Protein (CACYBP) (AA 160-175), (Middle Region) antibodyCACYBP Reaktivität: Human, Ratte WB, ICC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CACYBP Blocking Peptide, catalog no. 33R-3089, is also available for use as a blocking control in assays to test for specificity of this CACYBP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACYBP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CACYBP (Calcyclin Binding Protein (CACYBP))
- Andere Bezeichnung
- CACYBP (CACYBP Produkte)
- Synonyme
- zgc:76993 antikoerper, CACYBP antikoerper, sip antikoerper, gig5 antikoerper, pnas-107 antikoerper, s100a6bp antikoerper, T1P2.12 antikoerper, T1P2_12 antikoerper, GIG5 antikoerper, RP1-102G20.6 antikoerper, S100A6BP antikoerper, SIP antikoerper, calcyclin binding protein antikoerper, calcyclin binding protein, putative antikoerper, Calcyclin binding protein, putative antikoerper, SGS domain-containing protein antikoerper, calcyclin binding protein L homeolog antikoerper, cacybp antikoerper, CACYBP antikoerper, PB000926.02.0 antikoerper, PCHAS_145490 antikoerper, PVX_100855 antikoerper, PKH_145680 antikoerper, AT1G30070 antikoerper, cacybp.L antikoerper, Cacybp antikoerper
- Hintergrund
- CACYBP is a calcyclin binding protein. It may be involved in calcium-dependent ubiquitination and subsequent proteosomal degradation of target proteins. It probably serves as a molecular bridge in ubiquitin E3 complexes and participates in the ubiquitin-mediated degradation of beta-catenin.
- Molekulargewicht
- 26 kDa (MW of target protein)
- Pathways
- Response to Growth Hormone Stimulus
-
