CACYBP Antikörper (Middle Region)

Produktnummer ABIN629637

Produktdetails anti-CACYBP Antikörper

Target: CACYBP (Calcyclin Binding Protein (CACYBP))

Bindungsspezifität: Middle Region

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CACYBP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CACYBP antibody was raised against the middle region of CACYBP

Aufreinigung: Purified

Immunogen: CACYBP antibody was raised using the middle region of CACYBP corresponding to a region with amino acids FTERSFDLLVKNLNGKSYSMIVNNLLKPISVEGSSKKVKTDTVLILCRKK

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CACYBP Blocking Peptide, catalog no. 33R-3089, is also available for use as a blocking control in assays to test for specificity of this CACYBP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACYBP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CACYBP

Target: CACYBP (Calcyclin Binding Protein (CACYBP))

Andere Bezeichnung: CACYBP (CACYBP Produkte)

Hintergrund: CACYBP is a calcyclin binding protein. It may be involved in calcium-dependent ubiquitination and subsequent proteosomal degradation of target proteins. It probably serves as a molecular bridge in ubiquitin E3 complexes and participates in the ubiquitin-mediated degradation of beta-catenin.

Molekulargewicht: 26 kDa (MW of target protein)

Pathways: Response to Growth Hormone Stimulus