WDR4 Antikörper (C-Term)
-
- Target Alle WDR4 Antikörper anzeigen
- WDR4 (WD Repeat Domain 4 (WDR4))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser WDR4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- WDR4 antibody was raised against the C terminal of WDR4
- Aufreinigung
- Purified
- Immunogen
- WDR4 antibody was raised using the C terminal of WDR4 corresponding to a region with amino acids AGADASFSSLYKATFDNVTSYLKKKEERLQQQLEKKQRRRSPPPGPDGHA
- Top Product
- Discover our top product WDR4 Primärantikörper
-
anti-WD Repeat Domain 4 (WDR4) (AA 1-266) antibody
WDR4 Reaktivität: Human WB, ELISA, IHC (p) Wirt: Maus Monoclonal 1F9 unconjugated
anti-WD Repeat Domain 4 (WDR4) (AA 1-412) antibodyWDR4 Reaktivität: Human WB, IP, IF Wirt: Kaninchen Polyclonal unconjugated
anti-WD Repeat Domain 4 (WDR4) antibodyWDR4 Reaktivität: Human WB, IHC Wirt: Kaninchen Monoclonal unconjugated
anti-WD Repeat Domain 4 (WDR4) antibodyWDR4 Reaktivität: Human, Maus WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-WD Repeat Domain 4 (WDR4) (C-Term) antibodyWDR4 Reaktivität: Human, Maus, Ratte WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-WD Repeat Domain 4 (WDR4) (AA 146-173) antibodyWDR4 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB36209 unconjugated
anti-WD Repeat Domain 4 (WDR4) (AA 20-250) antibodyWDR4 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-WD Repeat Domain 4 (WDR4) (AA 36-85) antibodyWDR4 Reaktivität: Human, Pferd, Hund, Meerschweinchen, Fledermaus, Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-WD Repeat Domain 4 (WDR4) (N-Term) antibodyWDR4 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-WD Repeat Domain 4 (WDR4) (C-Term) antibodyWDR4 Reaktivität: Human, Maus, Ratte, Pferd, Kaninchen, Rind (Kuh), Saccharomyces cerevisiae, Schwein WB, IHC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
WDR4 Blocking Peptide, catalog no. 33R-1185, is also available for use as a blocking control in assays to test for specificity of this WDR4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- WDR4 (WD Repeat Domain 4 (WDR4))
- Andere Bezeichnung
- WDR4 (WDR4 Produkte)
- Synonyme
- TRM82 antikoerper, TRMT82 antikoerper, AI415180 antikoerper, AI448349 antikoerper, D530049K22Rik antikoerper, WD repeat domain 4 antikoerper, WD repeat domain 4 S homeolog antikoerper, WDR4 antikoerper, Wdr4 antikoerper, wdr4.S antikoerper
- Hintergrund
- WDR4 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.
- Molekulargewicht
- 45 kDa (MW of target protein)
-
