ACTN2 Antikörper (C-Term)

Produktnummer ABIN629641

Produktdetails anti-ACTN2 Antikörper

Target: ACTN2 (Actinin, alpha 2 (ACTN2))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACTN2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: Alpha Actinin 2 antibody was raised against the C terminal of ACTN2

Aufreinigung: Purified

Immunogen: alpha Actinin 2 antibody was raised using the C terminal of ACTN2 corresponding to a region with amino acids VIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALD

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Alpha Actinin 2 Blocking Peptide, catalog no. 33R-9587, is also available for use as a blocking control in assays to test for specificity of this Alpha Actinin 2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTN2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Referenzen für anti-ACTN2 Antikörper (ABIN629641)

Chopra, Kutys, Zhang, Polacheck, Sheng, Luu, Eyckmans, Hinson, Seidman, Seidman, Chen: "Force Generation via β-Cardiac Myosin, Titin, and α-Actinin Drives Cardiac Sarcomere Assembly from Cell-Matrix Adhesions." in: Developmental cell, Vol. 44, Issue 1, pp. 87-96.e5, (2018) (PubMed).

Details zu ACTN2

Target: ACTN2 (Actinin, alpha 2 (ACTN2))

Andere Bezeichnung: alpha Actinin 2 (ACTN2 Produkte)

Synonyme: MGC89234 antikoerper, ACTN2 antikoerper, 1110008F24Rik antikoerper, CMD1AA antikoerper, wu:fd44c03 antikoerper, zgc:123223 antikoerper, actinin alpha 2 antikoerper, actinin, alpha 2b antikoerper, actinin alpha 2 S homeolog antikoerper, actn2 antikoerper, ACTN2 antikoerper, Actn2 antikoerper, actn2b antikoerper, actn2.S antikoerper

Hintergrund: The alpha-actinins are a multigene family of four actin-binding proteins related to dystrophin. The two skeletal muscle isoforms of alpha-actinin (ACTN2 and ACTN3) are major structural components of the Z-line involved in anchoring the actin-containing thin filaments. In humans, ACTN2 is expressed in all muscle fibres, while ACTN3 expression is restricted to a subset of type 2 fibres. Murine Actn2 and Actn3 are differentially expressed, spatially and temporally, during embryonic development and, in contrast to humans, alpha-actinin-2 expression does not completely overlap alpha-actinin-3 in postnatal skeletal muscle, suggesting independent function.

Molekulargewicht: 98 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Skeletal Muscle Fiber Development, Negative Regulation of Transporter Activity