RSRC2 Antikörper (C-Term)
-
- Target Alle RSRC2 Antikörper anzeigen
- RSRC2 (arginine/serine-Rich Coiled-Coil 2 (RSRC2))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RSRC2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- RSRC2 antibody was raised against the C terminal of RSRC2
- Aufreinigung
- Purified
- Immunogen
- RSRC2 antibody was raised using the C terminal of RSRC2 corresponding to a region with amino acids DQNVKFRKLMGIKSEDEAGCSSVDEESYKTLKQQEEVFRNLDAQYEMARS
-
anti-arginine/serine-Rich Coiled-Coil 2 (RSRC2) (AA 363-412) antibody
RSRC2 Reaktivität: Human, Maus, Ratte, Hund, Kaninchen, Rind (Kuh), Meerschweinchen, Pferd, Fledermaus, Huhn, Affe, Schwein WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-arginine/serine-Rich Coiled-Coil 2 (RSRC2) (C-Term) antibodyRSRC2 Reaktivität: Human, Maus, Ratte, Hund, Kaninchen, Rind (Kuh), Meerschweinchen, Pferd WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-arginine/serine-Rich Coiled-Coil 2 (RSRC2) (AA 8-37), (N-Term) antibodyRSRC2 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB37755 unconjugated
-
- Applikationshinweise
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RSRC2 Blocking Peptide, catalog no. 33R-2134, is also available for use as a blocking control in assays to test for specificity of this RSRC2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RSRC2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RSRC2 (arginine/serine-Rich Coiled-Coil 2 (RSRC2))
- Andere Bezeichnung
- RSRC2 (RSRC2 Produkte)
- Synonyme
- 1500011J06Rik antikoerper, flj11021 antikoerper, ik:tdsubc_1d5 antikoerper, si:ch211-110p13.2 antikoerper, wu:fc56g08 antikoerper, xx:tdsubc_1d5 antikoerper, zgc:85695 antikoerper, arginine and serine rich coiled-coil 2 antikoerper, arginine/serine-rich coiled-coil 2 antikoerper, arginine/serine-rich coiled-coil 2 L homeolog antikoerper, RSRC2 antikoerper, Rsrc2 antikoerper, rsrc2.L antikoerper, rsrc2 antikoerper
- Hintergrund
- In vitro study revealed that RSRC2 might play a role in cell proliferation. RSRC2 may be a novel tumor suppressor of esophageal cancer cell growth.
- Molekulargewicht
- 50 kDa (MW of target protein)
-
