FAM107A Antikörper (Middle Region)
-
- Target Alle FAM107A Antikörper anzeigen
- FAM107A (Family with Sequence Similarity 107, Member A (FAM107A))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FAM107A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FAM107 A antibody was raised against the middle region of FAM107
- Aufreinigung
- Purified
- Immunogen
- FAM107 A antibody was raised using the middle region of FAM107 corresponding to a region with amino acids RLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSE
- Top Product
- Discover our top product FAM107A Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.0625 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FAM107A Blocking Peptide, catalog no. 33R-8045, is also available for use as a blocking control in assays to test for specificity of this FAM107A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM100 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FAM107A (Family with Sequence Similarity 107, Member A (FAM107A))
- Andere Bezeichnung
- FAM107A (FAM107A Produkte)
- Synonyme
- drr1 antikoerper, tu3a antikoerper, xdrr1 antikoerper, DRR1 antikoerper, TU3A antikoerper, Drr1 antikoerper, RGD1306327 antikoerper, Tu3a antikoerper, family with sequence similarity 107 member A S homeolog antikoerper, family with sequence similarity 107 member A antikoerper, family with sequence similarity 107, member A antikoerper, fam107a.S antikoerper, FAM107A antikoerper, Fam107a antikoerper
- Hintergrund
- When FAM107A is transfected into cell lines in which it is not expressed, it suppresses cell growth. It may play a role in tumor development.
- Molekulargewicht
- 17 kDa (MW of target protein)
-