AKR1B1 Antikörper
-
- Target Alle AKR1B1 Antikörper anzeigen
- AKR1B1 (Aldo-Keto Reductase Family 1, Member B1 (Aldose Reductase) (AKR1B1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser AKR1B1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- AKR1 B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLI
- Top Product
- Discover our top product AKR1B1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
AKR1B1 Blocking Peptide, catalog no. 33R-7728, is also available for use as a blocking control in assays to test for specificity of this AKR1B1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKR0 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- AKR1B1 (Aldo-Keto Reductase Family 1, Member B1 (Aldose Reductase) (AKR1B1))
- Andere Bezeichnung
- AKR1B1 (AKR1B1 Produkte)
- Synonyme
- ADR antikoerper, ALDR1 antikoerper, ALR2 antikoerper, AR antikoerper, ALDRED antikoerper, ALR-P-I antikoerper, Akr1b3 antikoerper, Akr1b4 antikoerper, Aldr1 antikoerper, Alr antikoerper, RATALDRED antikoerper, akr1b7 antikoerper, zgc:86611 antikoerper, aldo-keto reductase family 1 member B antikoerper, aldo-keto reductase family 1, member B1 (aldose reductase) antikoerper, aldo-keto reductase family 1, member B1 (aldose reductase) S homeolog antikoerper, AKR1B1 antikoerper, Akr1b1 antikoerper, akr1b1.S antikoerper, akr1b1 antikoerper
- Hintergrund
- AKR1B1 is a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol.
- Molekulargewicht
- 36 kDa (MW of target protein)
- Pathways
- Metabolism of Steroid Hormones and Vitamin D, C21-Steroid Hormone Metabolic Process, Monocarboxylic Acid Catabolic Process
-