PCMTD1 Antikörper

Produktnummer ABIN629648

Produktdetails anti-PCMTD1 Antikörper

Target: PCMTD1 (Protein-L-Isoaspartate (D-Aspartate) O-Methyltransferase Domain Containing 1 (PCMTD1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PCMTD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: PCMTD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TGQNTWESKNILAVSFAPLVQPSKNDNGKPDSVGLPPCAVRNLQDLARIY

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PCMTD1 Blocking Peptide, catalog no. 33R-9092, is also available for use as a blocking control in assays to test for specificity of this PCMTD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCMTD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PCMTD1

Target: PCMTD1 (Protein-L-Isoaspartate (D-Aspartate) O-Methyltransferase Domain Containing 1 (PCMTD1))

Andere Bezeichnung: PCMTD1 (PCMTD1 Produkte)

Synonyme: fd15e12 antikoerper, wu:fd15e12 antikoerper, wu:fi15f10 antikoerper, zgc:123165 antikoerper, 8430411F12Rik antikoerper, A030012M09Rik antikoerper, RGD1307986 antikoerper, protein-L-isoaspartate (D-aspartate) O-methyltransferase domain containing 1 antikoerper, Protein-L-isoaspartate O-methyltransferase domain-containing protein 1 antikoerper, pcmtd1 antikoerper, pcmd1 antikoerper, PCMTD1 antikoerper, Pcmtd1 antikoerper

Hintergrund: The function of PCMTD1 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 41 kDa (MW of target protein)