Asialoglycoprotein Receptor 1 Antikörper (N-Term)
-
- Target Alle Asialoglycoprotein Receptor 1 (ASGR1) Antikörper anzeigen
- Asialoglycoprotein Receptor 1 (ASGR1)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Asialoglycoprotein Receptor 1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ASGR1 antibody was raised against the N terminal of ASGR1
- Aufreinigung
- Purified
- Immunogen
- ASGR1 antibody was raised using the N terminal of ASGR1 corresponding to a region with amino acids RKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGS
- Top Product
- Discover our top product ASGR1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.6 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ASGR1 Blocking Peptide, catalog no. 33R-8004, is also available for use as a blocking control in assays to test for specificity of this ASGR1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASGR1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Asialoglycoprotein Receptor 1 (ASGR1)
- Andere Bezeichnung
- ASGR1 (ASGR1 Produkte)
- Hintergrund
- ASGR1 encodes for a cell surface receptor binds to galactose-terminated glycoproteins. It transports these glycoproteins via a series of membrane vesicles and tubules to an acidic-sorting organelle where the receptor and ligand dissociates. Then the receptor is recycled back to the cell surface.
- Molekulargewicht
- 33 kDa (MW of target protein)
- Pathways
- Thyroid Hormone Synthesis
-