Liver Arginase Antikörper (Arg1, N-Term)

Produktnummer ABIN629657

Produktdetails anti-Liver Arginase Antikörper

Target: Liver Arginase (ARG1) (Arginase, Liver (ARG1))

Bindungsspezifität: Arg1, N-Term

Reaktivität: Human, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Liver Arginase Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: Arginase 1 antibody was raised against the N terminal of ARG1

Aufreinigung: Purified

Immunogen: Arginase 1 antibody was raised using the N terminal of ARG1 corresponding to a region with amino acids HSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLK

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Arginase 1 Blocking Peptide, catalog no. 33R-3855, is also available for use as a blocking control in assays to test for specificity of this Arginase 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARG1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Liver Arginase

Target: Liver Arginase (ARG1) (Arginase, Liver (ARG1))

Andere Bezeichnung: Arginase 1 (ARG1 Produkte)

Synonyme: SI:zC146F4.4 (novel protein with NUDIX domain) antikoerper, si:ch211-146f4.3 antikoerper, argi1 antikoerper, AI antikoerper, AI256583 antikoerper, Arg-1 antikoerper, PGIF antikoerper, arginase 1 antikoerper, arginase antikoerper, Arginase-1 antikoerper, arginase, liver antikoerper, L-arginase antikoerper, arg1 antikoerper, PGTG_16455 antikoerper, argi1 antikoerper, ARG1 antikoerper, Arg1 antikoerper

Hintergrund: Arginase catalyzes the hydrolysis of arginine to ornithine and urea. The type I isoform of ARG1, is a cytosolic enzyme and expressed predominantly in the liver as a component of the urea cycle. Inherited deficiency of this enzyme results in argininemia, an autosomal recessive disorder characterized by hyperammonemia.

Molekulargewicht: 35 kDa (MW of target protein)

Pathways: Cellular Response to Molecule of Bacterial Origin