ALG1L6P Antikörper (C-Term)

Produktnummer ABIN629659

Produktdetails anti-ALG1L6P Antikörper

Target: ALG1L6P (Asparagine-Linked Glycosylation 1 Homolog Pseudogene (ALG1L6P))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ALG1L6P Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LOC339879 antibody was raised against the C terminal of LOC339879

Aufreinigung: Purified

Immunogen: LOC339879 antibody was raised using the C terminal of LOC339879 corresponding to a region with amino acids HELVKHEENGLVFEDSEELAAQLQMLFSNFPDPAGKLNQFRKNLQESQQL

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LOC339879 Blocking Peptide, catalog no. 33R-3720, is also available for use as a blocking control in assays to test for specificity of this LOC339879 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOC339879 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ALG1L6P

Target: ALG1L6P (Asparagine-Linked Glycosylation 1 Homolog Pseudogene (ALG1L6P))

Andere Bezeichnung: LOC339879 (ALG1L6P Produkte)

Synonyme: asparagine-linked glycosylation 1-like 6, pseudogene antikoerper, ALG1L6P antikoerper

Hintergrund: The function of LOC339879 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 36 kDa (MW of target protein)